KEGG   Homo sapiens (human): 55801Help
Entry
55801             CDS       T01001                                 

Gene name
IL26, AK155, IL-26
Definition
interleukin 26
Orthology
K05446  
interleukin 26
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q15
AA seq 171 aa AA seqDB search
MLVNFILRCGLLLVTLSLAIAKHKQSSFTKSCYPRGTLSQAVDALYIKAAWLKATIPEDR
IKNIRLLKKKTKKQFMKNCQFQEQLLSFFMEDVFGQLQLQGCKKIRFVEDFHSLRQKLSH
CISCASSAREMKSITRMKRIFYRIGNKGIYKAISELDILLSWIKKLLESSQ
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgctggtgaatttcattttgaggtgtgggttgctgttagtcactctgtctcttgccatt
gccaagcacaagcaatcttccttcaccaaaagttgttacccaaggggaacattgtcccaa
gctgttgacgctctctatatcaaagcagcatggctcaaagcaacgattccagaagaccgc
ataaaaaatatacgattattaaaaaagaaaacaaaaaagcagtttatgaaaaactgtcaa
tttcaagaacagcttctgtccttcttcatggaagacgtttttggtcaactgcaattgcaa
ggctgcaagaaaatacgctttgtggaggactttcatagccttaggcagaaattgagccac
tgtatttcctgtgcttcatcagctagagagatgaaatccattaccaggatgaaaagaata
ttttataggattggaaacaaaggaatctacaaagccatcagtgaactggatattcttctt
tcctggattaaaaaattattggaaagcagtcagtaa

DBGET integrated database retrieval system