KEGG   Homo sapiens (human): 55812Help
Entry
55812             CDS       T01001                                 

Gene name
SPATA7, HEL-S-296, HSD-3.1, HSD3, LCA3
Definition
(RefSeq) spermatogenesis associated 7
  KO
K19655  
spermatogenesis-associated protein 7
Organism
hsa  Homo sapiens (human)
Disease
H00527  
Retinitis pigmentosa (RP)
H00837  
Leber congenital amaurosis (LCR)
Brite
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    55812 (SPATA7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q31.3
AA seq 599 aa AA seqDB search
MDGSRRVRATSVLPRYGPPCLFKGHLSTKSNAFCTDSSSLRLSTLQLVKNHMAVHYNKIL
SAKAAVDCSVPVSVSTSIKYADQQRREKLKKELAQCEKEFKLTKTAMRANYKNNSKSLFN
TLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSERLHLSLHKSSKVITNGPEKNSSSSP
SSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPF
TPRTLKTEAKSFLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEM
NIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDDALQHSSPRAMCQYSLKPPSTRKIYS
DEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLG
CTSEENSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKD
ENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNLETSTLDENHPSISDSLTDRETSVNV
IEGDSDPEKVEISNGLCGLNTSPSQSVQFSSVKGDNNHDMELSTLKIMEMSIEDCPLDV
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atggatggcagccggagagtcagagcaacctctgtccttcccagatatggtccaccgtgc
ctatttaaaggacacttgagcaccaaaagtaatgctttttgcactgactcctcttctctc
agactaagcactctccagctggtcaagaatcacatggctgttcactataataaaatcctt
tcagccaaagctgcagtagactgctcggttccagtaagcgtgagtaccagcataaagtat
gcagaccaacaacgaagagagaaactcaaaaaggaattagcacaatgtgaaaaagagttc
aaattaactaaaactgcaatgcgagccaattataaaaataattccaagtcactttttaat
accttacaaaagccctcaggcgaaccgcaaattgaggatgacatgttaaaagaagaaatg
aatggattttcatcctttgcaaggtcactagtaccctcttcagagagactacacctaagt
ctacataaatccagtaaagtcatcacaaatggtcctgagaagaactccagttcctccccg
tccagtgtggattatgcagcctccgggccccggaaactgagctctggagccctgtatggc
agaaggcccagaagcacattcccaaattcccaccggtttcagttagtcatttcgaaagca
cccagtggggatcttttggataaacattctgaactcttttctaacaaacaattgccattc
actcctcgcactttaaaaacagaagcaaaatctttcctgtcacagtatcgctattataca
cctgccaaaagaaaaaaggattttacagatcaacggatagaagctgaaacccagactgaa
ttaagctttaaatctgagttggggacagctgagactaaaaacatgacagattcagaaatg
aacataaagcaggcatctaattgtgtgacatatgatgccaaagaaaaaatagctccttta
cctttagaagggcatgactcaacatgggatgagattaaggatgatgctcttcagcattcc
tcaccaagggcaatgtgtcagtattccctgaagcccccttcaactcgtaaaatctactct
gatgaagaagaactgttgtatctgagtttcattgaagatgtaacagatgaaattttgaaa
cttggtttattttcaaacaggtttttagaacgactgttcgagcgacatataaaacaaaat
aaacatttggaggaggaaaaaatgcgccacctgctgcatgtcctgaaagtagacttaggc
tgcacatcggaggaaaactcggtaaagcaaaatgatgttgatatgttgaatgtatttgat
tttgaaaaggctgggaattcagaaccaaatgaattaaaaaatgaaagtgaagtaacaatt
cagcaggaacgtcaacaataccaaaaggctttggatatgttattgtcggcaccaaaggat
gagaacgagatattcccttcaccaactgaatttttcatgcctatttataaatcaaagcat
tcagaaggggttataattcaacaggtgaatgatgaaacaaatcttgaaacttcaactttg
gatgaaaatcatccaagtatttcagacagtttaacagatcgggaaacttctgtgaatgtc
attgaaggtgatagtgaccctgaaaaggttgagatttcaaatggattatgtggtcttaac
acatcaccctcccaatctgttcagttctccagtgtcaaaggcgacaataatcatgacatg
gagttatcaactcttaaaatcatggaaatgagcattgaggactgccctttggatgtttaa

DBGET integrated database retrieval system