KEGG   Homo sapiens (human): 55821Help
Entry
55821             CDS       T01001                                 

Gene name
ALLC, ALC
Definition
allantoicase (EC:3.5.3.4)
Orthology
K01477  
allantoicase [EC:3.5.3.4]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    55821 (ALLC)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.4  allantoicase
     55821 (ALLC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q35
AA seq 391 aa AA seqDB search
MDMASESVGGKILFATDDFFAPAENLIKSDSPCFKEHEYTEFGKWMDGWETRRKRIPGHD
WCVLRLGIQGVIRGFDVDVSYFTGDYAPRVSIQAANLEEDKLPEIPERGTRTGAAATPEE
FEAIAELKSDDWSYLVPMTELKPGNPASGHNYFLVNSQQRWTHIRLNIFPDGGIARLRVF
GTGQKDWTATDPKEPADLVAIAFGGVCVGFSNAKFGHPNNIIGVGGAKSMADGWETARRL
DRPPILENDENGILLVPGCEWAVFRLAHPGVITRIEIDTKYFEGNAPDSCKVDGCILTTQ
EEEAVIRQKWILPAHKWKPLLPVTKLSPNQSHLFDSLTLELQDVITHARLTIVPDGGVSR
LRLRGFPSSICLLRPREKPMLKFSVSFKANP
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggacatggcatctgaatccgtaggaggaaaaattttatttgcaacagatgactttttt
gctcctgcagaaaacctcataaagagtgacagcccgtgcttcaaagagcatgaatatacg
gagtttgggaaatggatggatggctgggagaccaggaggaaaaggattccaggtcacgac
tggtgtgtcctcaggctggggatccaaggagtcatccggggcttcgacgtggacgtttct
tacttcacgggagattacgctcctcgagtgtccattcaagcagcaaacttggaagaagat
aaactaccagaaatcccagaaagaggaaccaggacaggagctgcagccactcctgaggag
tttgaagccattgctgagctaaaatccgacgactggagttacttggttcccatgactgag
cttaagccaggaaaccctgcttccggccacaactattttcttgtcaattcccagcagaga
tggactcatatcagactcaacattttcccagatggtggaattgcacgacttagagtattc
ggtactggacaaaaagactggactgcaactgaccccaaagaacctgcagacctagtggcc
atcgcttttgggggtgtctgtgtaggatttagtaatgctaagtttgggcacccaaacaat
ataataggagttggcggggcaaagtctatggcggatggttgggaaactgcaagaaggctg
gaccggccaccaatattagaaaatgatgagaatggcattctcttggttccgggttgtgaa
tgggcagttttccgattggcacatcctggagtaataactcgaattgaaattgacacaaaa
tattttgaaggcaatgctcctgacagctgtaaagtggatgggtgcatcctgacaactcag
gaagaagaagccgtgatcaggcaaaagtggattctcccggcccacaagtggaaaccactg
cttccagtgaccaagttgtctcccaaccaaagtcatctgttcgatagcctgaccctagag
ctccaagatgtcatcactcacgccaggctcaccatcgtccccgacgggggagtgagccgc
cttcggctccggggcttccccagctccatctgcctcctgaggccccgggagaagcccatg
ttgaagttctcggtgagcttcaaagcaaacccttaa

DBGET integrated database retrieval system