KEGG   Homo sapiens (human): 55821Help
Entry
55821             CDS       T01001                                 

Gene name
ALLC, ALC
Definition
(RefSeq) allantoicase
  KO
K01477  allantoicase [EC:3.5.3.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    55821 (ALLC)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.4  allantoicase
     55821 (ALLC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Allantoicase
Motif
Other DBs
NCBI-GeneID: 55821
NCBI-ProteinID: NP_060906
OMIM: 612396
HGNC: 17377
Ensembl: ENSG00000151360
Vega: OTTHUMG00000151485
Pharos: Q8N6M5(Tdark)
UniProt: Q8N6M5
Position
2p25.3
AA seq 391 aa AA seqDB search
MDMASESVGGKILFATDDFFAPAENLIKSDSPCFKEHEYTEFGKWMDGWETRRKRIPGHD
WCVLRLGIQGVIRGFDVDVSYFTGDYAPRVSIQAANLEEDKLPEIPERGTRTGAAATPEE
FEAIAELKSDDWSYLVPMTELKPGNPASGHNYFLVNSQQRWTHIRLNIFPDGGIARLRVF
GTGQKDWTATDPKEPADLVAIAFGGVCVGFSNAKFGHPNNIIGVGGAKSMADGWETARRL
DRPPILENDENGILLVPGCEWAVFRLAHPGVITRIEIDTKYFEGNAPDSCKVDGCILTTQ
EEEAVIRQKWILPAHKWKPLLPVTKLSPNQSHLFDSLTLELQDVITHARLTIVPDGGVSR
LRLRGFPSSICLLRPREKPMLKFSVSFKANP
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggacatggcatctgaatccgtaggaggaaaaattttatttgcaacagatgactttttt
gctcctgcagaaaacctcataaagagtgacagcccgtgcttcaaagagcatgaatatacg
gagtttgggaaatggatggatggctgggagaccaggaggaaaaggattccaggtcacgac
tggtgtgtcctcaggctggggatccaaggagtcatccggggcttcgacgtggacgtttct
tacttcacgggagattacgctcctcgagtgtccattcaagcagcaaacttggaagaagat
aaactaccagaaatcccagaaagaggaaccaggacaggagctgcagccactcctgaggag
tttgaagccattgctgagctaaaatccgacgactggagttacttggttcccatgactgag
cttaagccaggaaaccctgcttccggccacaactattttcttgtcaattcccagcagaga
tggactcatatcagactcaacattttcccagatggtggaattgcacgacttagagtattc
ggtactggacaaaaagactggactgcaactgaccccaaagaacctgcagacctagtggcc
atcgcttttgggggtgtctgtgtaggatttagtaatgctaagtttgggcacccaaacaat
ataataggagttggcggggcaaagtctatggcggatggttgggaaactgcaagaaggctg
gaccggccaccaatattagaaaatgatgagaatggcattctcttggttccgggttgtgaa
tgggcagttttccgattggcacatcctggagtaataactcgaattgaaattgacacaaaa
tattttgaaggcaatgctcctgacagctgtaaagtggatgggtgcatcctgacaactcag
gaagaagaagccgtgatcaggcaaaagtggattctcccggcccacaagtggaaaccactg
cttccagtgaccaagttgtctcccaaccaaagtcatctgttcgatagcctgaccctagag
ctccaagatgtcatcactcacgccaggctcaccatcgtccccgacgggggagtgagccgc
cttcggctccggggcttccccagctccatctgcctcctgaggccccgggagaagcccatg
ttgaagttctcggtgagcttcaaagcaaacccttaa

DBGET integrated database retrieval system