KEGG   Homo sapiens (human): 55845Help
Entry
55845             CDS       T01001                                 

Gene name
BRK1, C3orf10, MDS027, hHBrk1
Definition
BRICK1, SCAR/WAVE actin-nucleating complex subunit
Orthology
K05752  
chromosome 3 open reading frame 10
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    55845 (BRK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p25.3
AA seq 75 aa AA seqDB search
MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR
IEYIEARVTKGETLT
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atggcgggacaggaggatccggtgcagcgggagattcaccaggactgggctaaccgggag
tacattgagataatcaccagcagcatcaagaaaatcgcagactttctcaactcgttcgat
atgtcttgtcgttcaagacttgcaacactaaacgagaaattgacagcccttgaacggaga
atagagtacattgaagctcgggtgacaaaaggtgagacactcacctag

DBGET integrated database retrieval system