KEGG   Homo sapiens (human): 55851Help
Entry
55851             CDS       T01001                                 

Gene name
PSENEN, MSTP064, PEN-2, PEN2
Definition
presenilin enhancer gamma secretase subunit
Orthology
K06170  
presenilin enhancer 2
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Alzheimer's disease
Disease
H00681  
Acne inversa
Drug target
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:hsa04330]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:hsa05010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
19q13.12
AA seq 101 aa AA seqDB search
MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRS
AVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgaacctggagcgagtgtccaatgaggagaaattgaacctgtgccggaagtactacctg
ggggggtttgctttcctgccttttctctggttggtcaacatcttctggttcttccgagag
gccttccttgtcccagcctacacagaacagagccaaatcaaaggctatgtctggcgctca
gctgtgggcttcctcttctgggtgatagtgctcacctcctggatcaccatcttccagatc
taccggccccgctggggtgcccttggggactacctctccttcaccatacccctgggcacc
ccctga

DBGET integrated database retrieval system