KEGG   Homo sapiens (human): 55867Help
Entry
55867             CDS       T01001                                 

Gene name
SLC22A11, OAT4, hOAT4
Definition
(RefSeq) solute carrier family 22 member 11
  KO
K08207  
MFS transporter, OCT family, solute carrier family 22 (organic anion/cation transporter), member 11
Organism
hsa  Homo sapiens (human)
Drug target
Lesinurad: 
Brite
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   55867 (SLC22A11)
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    55867 (SLC22A11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13.1
AA seq 550 aa AA seqDB search
MAFSKLLEQAGGVGLFQTLQVLTFILPCLMIPSQMLLENFSAAIPGHRCWTHMLDNGSAV
STNMTPKALLTISIPPGPNQGPHQCRRFRQPQWQLLDPNATATSWSEADTEPCVDGWVYD
RSVFTSTIVAKWDLVCSSQGLKPLSQSIFMSGILVGSFIWGLLSYRFGRKPMLSWCCLQL
AVAGTSTIFAPTFVIYCGLRFVAAFGMAGIFLSSLTLMVEWTTTSRRAVTMTVVGCAFSA
GQAALGGLAFALRDWRTLQLAASVPFFAISLISWWLPESARWLIIKGKPDQALQELRKVA
RINGHKEAKNLTIEVLMSSVKEEVASAKEPRSVLDLFCVPVLRWRSCAMLVVNFSLLISY
YGLVFDLQSLGRDIFLLQALFGAVDFLGRATTALLLSFLGRRTIQAGSQAMAGLAILANM
LVPQDLQTLRVVFAVLGKGCFGISLTCLTIYKAELFPTPVRMTADGILHTVGRLGAMMGP
LILMSRQALPLLPPLLYGVISIASSLVVLFFLPETQGLPLPDTIQDLESQKSTAAQGNRQ
EAVTVESTSL
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggcgttctcgaagctcttggagcaagccggaggcgtgggcctcttccagaccctgcag
gtgctcaccttcatcctcccctgcctcatgataccttcccagatgctcctggagaacttc
tcagccgccatcccaggccaccgatgctggacacacatgctggacaatggctctgcggtt
tccacaaacatgacccccaaggcccttctgaccatctccatcccgccaggccccaaccag
gggccccaccagtgccgccgcttccgccagccacagtggcagctcttggaccccaatgcc
acggccaccagctggagcgaagctgacacggagccgtgtgtggacggctgggtctatgac
cgcagcgtcttcacctccaccatcgtggccaagtgggacctggtgtgcagctcccagggc
ttgaagcccctaagccagtccatcttcatgtccgggatcctggtgggctcctttatctgg
ggcctcctctcctaccggtttgggaggaagccgatgctgagctggtgctgcctgcagttg
gccgtggcgggcaccagcaccatcttcgccccaacattcgtcatctactgcggcctgcgg
ttcgtggccgcttttgggatggccggcatctttctgagttcactgacactgatggtggag
tggaccacgaccagcaggagggcggtcaccatgacggtggtgggatgtgccttcagcgca
ggccaggcggcgctgggcggcctggcctttgccctgcgggactggaggactctccagctg
gcagcatcagtgcccttctttgccatctccctgatatcctggtggctgccagaatccgcc
cggtggctgattattaagggcaaaccagaccaagcacttcaggagctcagaaaggtggcc
aggataaatggccacaaggaggccaagaacctgaccatagaggtgctgatgtccagcgtg
aaggaggaggtggcctctgcaaaggagccgcggtcggtgctggacctgttctgcgtgccc
gtgctccgctggaggagctgcgccatgctggtggtgaatttctctctattgatctcctac
tatgggctggtcttcgacctgcagagcctgggccgtgacatcttcctcctccaggccctc
ttcggggccgtggacttcctgggccgggccaccactgccctcttgctcagtttccttggc
cgccgcaccatccaggcgggttcccaggccatggccggcctcgccattctagccaacatg
ctggtgccgcaagatttgcagaccctgcgtgtggtctttgctgtgctgggaaagggatgt
tttgggataagcctaacctgcctcaccatctacaaggctgaactctttccaacgccagtg
cggatgacagcagatggcattctgcatacagtgggccggctgggggctatgatgggtccc
ctgatcctgatgagccgccaagccctgcccctgctgcctcctctcctctatggcgttatc
tccattgcttccagcctggttgtgctgttcttcctcccggagacccagggacttccgctc
cctgacactatccaggacctggagagccagaaatcaacagcagcccagggcaaccggcaa
gaggccgtcactgtggaaagtacctcgctctag

DBGET integrated database retrieval system