KEGG   Homo sapiens (human): 55869Help
Entry
55869             CDS       T01001                                 

Gene name
HDAC8, CDLS5, HD8, HDACL1, MRXS6, RPD3, WTS
Definition
histone deacetylase 8 (EC:3.5.1.98)
Orthology
K11405  
histone deacetylase 8 [EC:3.5.1.98]
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Viral carcinogenesis
Drug target
Romidepsin: 
Panobinostat: 
Valproic acid: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    55869 (HDAC8)
  Substance dependence
   05034 Alcoholism
    55869 (HDAC8)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     55869 (HDAC8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xq13
AA seq 286 aa AA seqDB search
MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRDEASG
FCYLNDAVLGILRLRRKFERILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGT
GDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAG
DPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEI
PDHEFFTAYGPDYVLEITPSCRPDRNEPHRIQQILNYIKGNLKHVV
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggaggagccggaggaaccggcggacagtgggcagtcgctggtcccggtttatatctat
agtcccgagtatgtcagtatgtgtgactccctggccaagatccccaaacgggccagtatg
gtgcattctttgattgaagcatatgcactgcataagcagatgagagatgaagcatctggt
ttttgttatctcaatgatgctgtcctgggaatattacgattgcgacggaaatttgagcgt
attctctacgtggatttggatctgcaccatggagatggtgtagaagacgcattcagtttc
acctccaaagtcatgaccgtgtccctgcacaaattctccccaggatttttcccaggaaca
ggtgacgtgtctgatgttggcctagggaagggacggtactacagtgtaaatgtgcccatt
caggatggcatacaagatgaaaaatattaccagatctgtgaaagtgtactaaaggaagta
taccaagcctttaatcccaaagcagtggtcttacagctgggagctgacacaatagctggg
gatcccatgtgctcctttaacatgactccagtgggaattggcaagtgtcttaagtacatc
cttcaatggcagttggcaacactcattttgggaggaggaggctataaccttgccaacacg
gctcgatgctggacatacttgaccggggtcatcctagggaaaacactatcctctgagatc
ccagatcatgagtttttcacagcatatggtcctgattatgtgctggaaatcacgccaagc
tgccggccagaccgcaatgagccccaccgaatccaacaaatcctcaactacatcaaaggg
aatctgaagcatgtggtctag

DBGET integrated database retrieval system