KEGG   Homo sapiens (human): 5587Help
Entry
5587              CDS       T01001                                 

Gene name
PRKD1, PKC-MU, PKCM, PKD, PRKCM
Definition
(RefSeq) protein kinase D1 (EC:2.7.11.13)
  KO
K06070  
protein kinase D [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    5587 (PRKD1)
 Organismal Systems
  Endocrine system
   04925 Aldosterone synthesis and secretion
    5587 (PRKD1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     5587 (PRKD1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  PKD family
   5587 (PRKD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q11
AA seq 912 aa AA seqDB search
MSAPPVLRPPSPLLPVAAAAAAAAAALVPGSGPGPAPFLAPVAAPVGGISFHLQIGLSRE
PVLLLQDSSGDYSLAHVREMACSIVDQKFPECGFYGMYDKILLFRHDPTSENILQLVKAA
SDIQEGDLIEVVLSASATFEDFQIRPHALFVHSYRAPAFCDHCGEMLWGLVRQGLKCEGC
GLNYHKRCAFKIPNNCSGVRRRRLSNVSLTGVSTIRTSSAELSTSAPDEPLLQKSPSESF
IGREKRSNSQSYIGRPIHLDKILMSKVKVPHTFVIHSYTRPTVCQYCKKLLKGLFRQGLQ
CKDCRFNCHKRCAPKVPNNCLGEVTINGDLLSPGAESDVVMEEGSDDNDSERNSGLMDDM
EEAMVQDAEMAMAECQNDSGEMQDPDPDHEDANRTISPSTSNNIPLMRVVQSVKHTKRKS
STVMKEGWMVHYTSKDTLRKRHYWRLDSKCITLFQNDTGSRYYKEIPLSEILSLEPVKTS
ALIPNGANPHCFEITTANVVYYVGENVVNPSSPSPNNSVLTSGVGADVARMWEIAIQHAL
MPVIPKGSSVGTGTNLHRDISVSISVSNCQIQENVDISTVYQIFPDEVLGSGQFGIVYGG
KHRKTGRDVAIKIIDKLRFPTKQESQLRNEVAILQNLHHPGVVNLECMFETPERVFVVME
KLHGDMLEMILSSEKGRLPEHITKFLITQILVALRHLHFKNIVHCDLKPENVLLASADPF
PQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRNKGYNRSLDMWSVGVIIYVSLSGT
FPFNEDEDIHDQIQNAAFMYPPNPWKEISHEAIDLINNLLQVKMRKRYSVDKTLSHPWLQ
DYQTWLDLRELECKIGERYITHESDDLRWEKYAGEQGLQYPTHLINPSASHSDTPETEET
EMKALGERVSIL
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcccctccggtcctgcggccgcccagtccgctgctgcccgtggcggcggcagct
gccgcagcggccgccgcactggtcccagggtccgggcccgggcccgcgccgttcttggct
cctgtcgcggccccggtcgggggcatctcgttccatctgcagatcggcctgagccgtgag
ccggtgctgctgctgcaggactcgtccggggactacagcctggcgcacgtccgcgagatg
gcttgctccattgtcgaccagaagttccctgaatgtggtttctacggaatgtatgataag
atcctgctttttcgccatgaccctacctctgaaaacatccttcagctggtgaaagcggcc
agtgatatccaggaaggcgatcttattgaagtggtcttgtcagcttccgccacctttgaa
gactttcagattcgtccccacgctctctttgttcattcatacagagctccagctttctgt
gatcactgtggagaaatgctgtgggggctggtacgtcaaggtcttaaatgtgaagggtgt
ggtctgaattaccataagagatgtgcatttaaaatacccaacaattgcagcggtgtgagg
cggagaaggctctcaaacgtttccctcactggggtcagcaccatccgcacatcatctgct
gaactctctacaagtgcccctgatgagccccttctgcaaaaatcaccatcagagtcgttt
attggtcgagagaagaggtcaaattctcaatcatacattggacgaccaattcaccttgac
aagattttgatgtctaaagttaaagtgccgcacacatttgtcatccactcctacacccgg
cccacagtgtgccagtactgcaagaagcttctgaaggggcttttcaggcagggcttgcag
tgcaaagattgcagattcaactgccataaacgttgtgcaccgaaagtaccaaacaactgc
cttggcgaagtgaccattaatggagatttgcttagccctggggcagagtctgatgtggtc
atggaagaagggagtgatgacaatgatagtgaaaggaacagtgggctcatggatgatatg
gaagaagcaatggtccaagatgcagagatggcaatggcagagtgccagaacgacagtggc
gagatgcaagatccagacccagaccacgaggacgccaacagaaccatcagtccatcaaca
agcaacaatatcccactcatgagggtagtgcagtctgtcaaacacacgaagaggaaaagc
agcacagtcatgaaagaaggatggatggtccactacaccagcaaggacacgctgcggaaa
cggcactattggagattggatagcaaatgtattaccctctttcagaatgacacaggaagc
aggtactacaaggaaattcctttatctgaaattttgtctctggaaccagtaaaaacttca
gctttaattcctaatggggccaatcctcattgtttcgaaatcactacggcaaatgtagtg
tattatgtgggagaaaatgtggtcaatccttccagcccatcaccaaataacagtgttctc
accagtggcgttggtgcagatgtggccaggatgtgggagatagccatccagcatgccctt
atgcccgtcattcccaagggctcctccgtgggtacaggaaccaacttgcacagagatatc
tctgtgagtatttcagtatcaaattgccagattcaagaaaatgtggacatcagcacagta
tatcagatttttcctgatgaagtactgggttctggacagtttggaattgtttatggagga
aaacatcgtaaaacaggaagagatgtagctattaaaatcattgacaaattacgatttcca
acaaaacaagaaagccagcttcgtaatgaggttgcaattctacagaaccttcatcaccct
ggtgttgtaaatttggagtgtatgtttgagacgcctgaaagagtgtttgttgttatggaa
aaactccatggagacatgctggaaatgatcttgtcaagtgaaaagggcaggttgccagag
cacataacgaagtttttaattactcagatactcgtggctttgcggcaccttcattttaaa
aatatcgttcactgtgacctcaaaccagaaaatgtgttgctagcctcagctgatcctttt
cctcaggtgaaactttgtgattttggttttgcccggatcattggagagaagtctttccgg
aggtcagtggtgggtacccccgcttacctggctcctgaggtcctaaggaacaagggctac
aatcgctctctagacatgtggtctgttggggtcatcatctatgtaagcctaagcggcaca
ttcccatttaatgaagatgaagacatacacgaccaaattcagaatgcagctttcatgtat
ccaccaaatccctggaaggaaatatctcatgaagccattgatcttatcaacaatttgctg
caagtaaaaatgagaaagcgctacagtgtggataagaccttgagccacccttggctacag
gactatcagacctggttagatttgcgagagctggaatgcaaaatcggggagcgctacatc
acccatgaaagtgatgacctgaggtgggagaagtatgcaggcgagcaggggctgcagtac
cccacacacctgatcaatccaagtgctagccacagtgacactcctgagactgaagaaaca
gaaatgaaagccctcggtgagcgtgtcagcatcctctga

DBGET integrated database retrieval system