KEGG   Homo sapiens (human): 55872Help
Entry
55872             CDS       T01001                                 

Gene name
PBK, CT84, HEL164, Nori-3, SPK, TOPK
Definition
PDZ binding kinase (EC:2.7.12.2)
Orthology
K08865  
PDZ-binding kinase [EC:2.7.12.2]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     55872 (PBK)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  TOPK family
   55872 (PBK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8p21.2
AA seq 333 aa AA seqDB search
MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSP
WAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGE
KSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFE
TIKICDVGVSLPLDENMTAPAFITILLVSVTDPEACYIGTEPWKPKEAVEENGVITDKAD
IFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDES
YQKVIELFSVCTNEDPKDRPSAAHIVEALETDV
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggaagggatcagtaatttcaagacaccaagcaaattatcagaaaaaaagaaatctgta
ttatgttcaactccaactataaatatcccggcctctccgtttatgcagaagcttggcttt
ggtactggggtaaatgtgtacctaatgaaaagatctccaagaggtttgtctcattctcct
tgggctgtaaaaaagattaatcctatatgtaatgatcattatcgaagtgtgtatcaaaag
agactaatggatgaagctaagattttgaaaagccttcatcatccaaacattgttggttat
cgtgcttttactgaagccaatgatggcagtctgtgtcttgctatggaatatggaggtgaa
aagtctctaaatgacttaatagaagaacgatataaagccagccaagatccttttccagca
gccataattttaaaagttgctttgaatatggcaagagggttaaagtatctgcaccaagaa
aagaaactgcttcatggagacataaagtcttcaaatgttgtaattaaaggcgattttgaa
acaattaaaatctgtgatgtaggagtctctctaccactggatgaaaatatgactgctcct
gccttcataaccatcttgcttgtttcagtgactgaccctgaggcttgttacattggcaca
gagccatggaaacccaaagaagctgtggaggagaatggtgttattactgacaaggcagac
atatttgcctttggccttactttgtgggaaatgatgactttatcgattccacacattaat
ctttcaaatgatgatgatgatgaagataaaacttttgatgaaagtgattttgatgatgaa
gcatactatgcagcgttgggaactaggccacctattaatatggaagaactggatgaatca
taccagaaagtaattgaactcttctctgtatgcactaatgaagaccctaaagatcgtcct
tctgctgcacacattgttgaagctctggaaacagatgtctag

DBGET integrated database retrieval system