KEGG   Homo sapiens (human): 55890Help
Entry
55890             CDS       T01001                                 

Gene name
GPRC5C, RAIG-3, RAIG3
Definition
(RefSeq) G protein-coupled receptor class C group 5 member C
  KO
K04620  
G protein-coupled receptor family C group 5 member C
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class C. Metabotropic glutamate receptor family
  Other
   Orphan GPRC5
    55890 (GPRC5C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
17q25
AA seq 453 aa AA seqDB search
MGTQPEPGLGARMAIHKALVMCLGLPLFLFPGAWAQGHVPPGCSQGLNPLYYNLCDRSGA
WGIVLEAVAGAGIVTTFVLTIILVASLPFVQDTKKRSLLGTQVFFLLGTLGLFCLVFACV
VKPDFSTCASRRFLFGVLFAICFSCLAAHVFALNFLARKNHGPRGWVIFTVALLLTLVEV
IINTEWLIITLVRGSGEGGPQGNSSAGWAVASPCAIANMDFVMALIYVMLLLLGAFLGAW
PALCGRYKRWRKHGVFVLLTTATSVAIWVVWIVMYTYGNKQHNSPTWDDPTLAIALAANA
WAFVLFYVIPEVSQVTKSSPEQSYQGDMYPTRGVGYETILKEQKGQSMFVENKAFSMDEP
VAAKRPVSPYSGYNGQLLTSVYQPTEMALMHKVPSEGAYDIILPRATANSQVMGSANSTL
RAEDMYSAQSHQAATPPKDGKNSQVFRNPYVWD
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggggacccaaccagagcctggcctgggagccaggatggccatccacaaagccttggtg
atgtgcctgggactgcctctcttcctgttcccaggggcctgggcccagggccatgtccca
cccggctgcagccaaggcctcaaccccctgtactacaacctgtgtgaccgctctggggcg
tggggcatcgtcctggaggccgtggctggggcgggcattgtcaccacgtttgtgctcacc
atcatcctggtggccagcctcccctttgtgcaggacaccaagaaacggagcctgctgggg
acccaggtattcttccttctggggaccctgggcctcttctgcctcgtgtttgcctgtgtg
gtgaagcccgacttctccacctgtgcctctcggcgcttcctctttggggttctgttcgcc
atctgcttctcttgtctggcggctcacgtctttgccctcaacttcctggcccggaagaac
cacgggccccggggctgggtgatcttcactgtggctctgctgctgaccctggtagaggtc
atcatcaatacagagtggctgatcatcaccctggttcggggcagtggcgagggcggccct
cagggcaacagcagcgcaggctgggccgtggcctccccctgtgccatcgccaacatggac
tttgtcatggcactcatctacgtcatgctgctgctgctgggtgccttcctgggggcctgg
cccgccctgtgtggccgctacaagcgctggcgtaagcatggggtctttgtgctcctcacc
acagccacctccgttgccatatgggtggtgtggatcgtcatgtatacttacggcaacaag
cagcacaacagtcccacctgggatgaccccacgctggccatcgccctcgccgccaatgcc
tgggccttcgtcctcttctacgtcatccccgaggtctcccaggtgaccaagtccagccca
gagcaaagctaccagggggacatgtaccccacccggggcgtgggctatgagaccatcctg
aaagagcagaagggtcagagcatgttcgtggagaacaaggccttttccatggatgagccg
gttgcagctaagaggccggtgtcaccatacagcgggtacaatgggcagctgctgaccagt
gtgtaccagcccactgagatggccctgatgcacaaagttccgtccgaaggagcttacgac
atcatcctcccacgggccaccgccaacagccaggtgatgggcagtgccaactcgaccctg
cgggctgaagacatgtactcggcccagagccaccaggcggccacaccgccgaaagacggc
aagaactctcaggtctttagaaacccctacgtgtgggactga

DBGET integrated database retrieval system