KEGG   Homo sapiens (human): 55902Help
Entry
55902             CDS       T01001                                 

Gene name
ACSS2, ACAS2, ACECS, ACS, ACSA, dJ1161H23.1
Definition
acyl-CoA synthetase short-chain family member 2 (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    55902 (ACSS2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    55902 (ACSS2)
   00620 Pyruvate metabolism
    55902 (ACSS2)
   00640 Propanoate metabolism
    55902 (ACSS2)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     55902 (ACSS2)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   55902 (ACSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
20q11.22
AA seq 714 aa AA seqDB search
MGLPEERVRSGSGSRGQEEAGAGGRARSWSPPPEVSRSAHVPSLQRYRELHRRSVEEPRE
FWGDIAKEFYWKTPCPGPFLRYNFDVTKGKIFIEWMKGATTNICYNVLDRNVHEKKLGDK
VAFYWEGNEPGETTQITYHQLLVQVCQFSNVLRKQGIQKGDRVAIYMPMIPELVVAMLAC
ARIGALHSIVFAGFSSESLCERILDSSCSLLITTDAFYRGEKLVNLKELADEALQKCQEK
GFPVRCCIVVKHLGRAELGMGDSTSQSPPIKRSCPDVQGKLKEKSKRVQPQISWNQGIDL
WWHELMQEAGDECEPEWCDAEDPLFILYTSGSTGKPKGVVHTVGGYMLYVATTFKYVFDF
HAEDVFWCTADIGWITGHSYVTYGPLANGATSVLFEGIPTYPDVNRLWSIVDKYKVTKFY
TAPTAIRLLMKFGDEPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGAQRCPIVDTFWQ
TETGGHMLTPLPGATPMKPGSATFPFFGVAPAILNESGEELEGEAEGYLVFKQPWPGIMR
TVYGNHERFETTYFKKFPGYYVTGDGCQRDQDGYYWITGRIDDMLNVSGHLLSTAEVESA
LVEHEAVAEAAVVGHPHPVKGECLYCFVTLCDGHTFSPKLTEELKKQIREKIGPIATPDY
IQNAPGLPKTRSGKIMRRVLRKIAQNDHDLGDMSTVADPSVISHLFSHRCLTIQ
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggggcttcctgaggagcgggtccggagcggcagcgggagccggggccaggaggaagct
ggagccggaggccgggcgcggagttggtctccgccgcccgaggtcagccgctccgcgcac
gtcccctcgctgcagcgctaccgcgagctgcaccggcgctccgtggaggagccgcgggaa
ttctggggagacattgccaaggaattttactggaagactccatgccctggcccattcctt
cggtacaactttgatgtgactaaagggaaaatcttcattgagtggatgaaaggagcaact
accaacatctgctacaatgtactggatcgaaatgtccatgagaaaaagcttggagataaa
gttgctttttactgggagggcaatgagccaggggagaccactcagatcacataccatcag
cttctggtccaagtgtgtcagttcagcaatgttctccgaaaacagggcattcagaagggg
gaccgagtggccatctacatgcctatgatcccagagcttgtggtggccatgctggcatgt
gcccgcattggggctttgcactccattgtgtttgcaggcttctcttcagagtctctatgt
gaacggatcttggattccagctgcagtcttctcatcactacagatgccttctacaggggg
gaaaagcttgtgaacctgaaggagctggctgacgaggccctgcagaagtgtcaggagaag
ggtttcccagtaagatgctgcattgtggtcaagcacctggggcgggcagagctcggcatg
ggtgactccaccagccagtcccccccaattaagaggtcatgcccagatgtgcagggtaaa
ctgaaagagaaatccaagcgtgttcagccccagatctcatggaaccaagggattgacttg
tggtggcatgagctcatgcaagaggcaggggatgagtgtgagcccgagtggtgtgatgcc
gaggacccactcttcatcctgtacaccagtggctccacaggcaaacccaagggtgtggtt
cacacagttgggggctacatgctctatgtagccacaaccttcaagtatgtgtttgacttc
catgcagaggatgtgttctggtgcacggcagacattggttggatcactggtcattcctac
gtcacctatgggccactggccaatggtgccaccagtgttttgtttgaggggattcccaca
tatccggacgtgaaccgcctgtggagcattgtggacaaatacaaggtgaccaagttctac
acagcacccacagccatccgtctgctcatgaagtttggagatgagcctgtcaccaagcat
agccgggcatccttgcaggtgttaggcacagtgggtgaacccatcaaccctgaggcctgg
ctatggtaccaccgggtggtaggtgcccagcgctgccccatcgtggacaccttctggcaa
acagagacaggtggccacatgttgactccccttcctggtgccacacccatgaaacccggt
tctgctactttcccattctttggtgtagctcctgcaatcctgaatgagtccggggaagag
ttggaaggtgaagctgaaggttatctggtgttcaagcagccctggccagggatcatgcgc
acagtctatgggaaccacgaacgctttgagacaacctactttaagaagtttcctggatac
tatgttacaggagatggctgccagcgggaccaggatggctattactggatcactggcagg
attgatgacatgctcaatgtatctggacacctgctgagtacagcagaggtggagtcagca
cttgtggaacatgaggctgttgcagaggcagctgtggtgggccaccctcatcctgtgaag
ggtgaatgcctctactgctttgtcaccttgtgtgatggccacaccttcagccccaagctc
accgaggagctcaagaagcagattagagaaaagattggccccattgccacaccagactac
atccagaatgcacctggcttgcctaaaacccgctcagggaaaatcatgaggcgagtgctt
cggaagattgctcagaatgaccatgacctcggggacatgtctactgtggctgacccatct
gtcatcagtcacctcttcagccaccgctgcctgaccatccagtga

DBGET integrated database retrieval system