KEGG   Homo sapiens (human): 55908Help
Entry
55908             CDS       T01001                                 

Gene name
ANGPTL8, C19orf80, PRO1185, PVPA599, RIFL, TD26
Definition
(RefSeq) angiopoietin like 8
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q6UXH0(Tbio)
UniProt: 
Position
19p13.2
AA seq 198 aa AA seqDB search
MPVPALCLLWALAMVTRPASAAPMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRL
TKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVA
QAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQ
QHRLRQIQERLHTAALPA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgccagtgcctgctctgtgcctgctctgggccctggcaatggtgacccggcctgcctca
gcggcccccatgggcggcccagaactggcacagcatgaggagctgaccctgctcttccat
gggaccctgcagctgggccaggccctcaacggtgtgtacaggaccacggagggacggctg
acaaaggccaggaacagcctgggtctctatggccgcacaatagaactcctggggcaggag
gtcagccggggccgggatgcagcccaggaacttcgggcaagcctgttggagactcagatg
gaggaggatattctgcagctgcaggcagaggccacagctgaggtgctgggggaggtggcc
caggcacagaaggtgctacgggacagcgtgcagcggctagaagtccagctgaggagcgcc
tggctgggccctgcctaccgagaatttgaggtcttaaaggctcacgctgacaagcagagc
cacatcctatgggccctcacaggccacgtgcagcggcagaggcgggagatggtggcacag
cagcatcggctgcgacagatccaggagagactccacacagcggcgctcccagcctga

DBGET integrated database retrieval system