KEGG   Homo sapiens (human): 55908Help
Entry
55908             CDS       T01001                                 

Gene name
ANGPTL8, C19orf80, PRO1185, PVPA599, RIFL, TD26
Definition
(RefSeq) angiopoietin like 8
  KO
K22289  angiopoietin-like 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04979 Cholesterol metabolism
    55908 (ANGPTL8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4201
Motif
Other DBs
NCBI-GeneID: 55908
NCBI-ProteinID: NP_061157
OMIM: 616223
HGNC: 24933
Ensembl: ENSG00000130173
Vega: OTTHUMG00000180829
Pharos: Q6UXH0(Tbio)
UniProt: Q6UXH0
Position
19p13.2
AA seq 198 aa AA seqDB search
MPVPALCLLWALAMVTRPASAAPMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRL
TKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVA
QAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQ
QHRLRQIQERLHTAALPA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgccagtgcctgctctgtgcctgctctgggccctggcaatggtgacccggcctgcctca
gcggcccccatgggcggcccagaactggcacagcatgaggagctgaccctgctcttccat
gggaccctgcagctgggccaggccctcaacggtgtgtacaggaccacggagggacggctg
acaaaggccaggaacagcctgggtctctatggccgcacaatagaactcctggggcaggag
gtcagccggggccgggatgcagcccaggaacttcgggcaagcctgttggagactcagatg
gaggaggatattctgcagctgcaggcagaggccacagctgaggtgctgggggaggtggcc
caggcacagaaggtgctacgggacagcgtgcagcggctagaagtccagctgaggagcgcc
tggctgggccctgcctaccgagaatttgaggtcttaaaggctcacgctgacaagcagagc
cacatcctatgggccctcacaggccacgtgcagcggcagaggcgggagatggtggcacag
cagcatcggctgcgacagatccaggagagactccacacagcggcgctcccagcctga

DBGET integrated database retrieval system