KEGG   Homo sapiens (human): 55958Help
Entry
55958             CDS       T01001                                 

Gene name
KLHL9
Definition
kelch-like family member 9
Orthology
K10447  
kelch-like protein 9/13
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    55958 (KLHL9)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   Cul3 complex
    target recognizing subunit (BTB)
     55958 (KLHL9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
9p22
AA seq 617 aa AA seqDB search
MKVSLGNGEMGVSAHLQPCKAGTTRFFTSNTHSSVVLQGFDQLRIEGLLCDVTLVPGDGD
EIFPVHRAMMASASDYFKAMFTGGMKEQDLMCIKLHGVNKVGLKKIIDFIYTAKLSLNMD
NLQDTLEAASFLQILPVLDFCKVFLISGVSLDNCVEVGRIANTYNLIEVDKYVNNFILKN
FPALLSTGEFLKLPFERLAFVLSSNSLKHCTELELFKAACRWLRLEDPRMDYAAKLMKNI
RFPLMTPQDLINYVQTVDFMRTDNTCVNLLLEASNYQMMPYMQPVMQSDRTAIRSDSTHL
VTLGGVLRQQLVVSKELRMYDERAQEWRSLAPMDAPRYQHGIAVIGNFLYVVGGQSNYDT
KGKTAVDTVFRFDPRYNKWMQVASLNEKRTFFHLSALKGHLYAVGGRSAAGELATVECYN
PRMNEWSYVAKMSEPHYGHAGTVYGGLMYISGGITHDTFQNELMCFDPDTDKWMQKAPMT
TVRGLHCMCTVGDKLYVIGGNHFRGTSDYDDVLSCEYYSPTLDQWTPIAAMLRGQSDVGV
AVFENKIYVVGGYSWNNRCMVEIVQKYDPEKDEWHKVFDLPESLGGIRACTLTVFPPEEN
PGSPSRESPLSAPSDHS
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgtcccttggtaacggcgaaatgggcgtctctgcccatttgcagccttgtaag
gcaggaaccacacgcttttttaccagcaatactcacagttcggtggtattgcaaggcttt
gatcagcttagaatagaaggattgctttgtgatgtgaccctggtaccaggtgatggagat
gaaatcttccctgttcacagagctatgatggcgtctgctagtgattatttcaaagccatg
ttcacaggtggaatgaaagaacaagatttgatgtgcattaagcttcatggggtgaacaag
gttggtctgaagaaaatcattgattttatttatactgcaaaactttctcttaatatggac
aatcttcaggacacacttgaagctgctagctttttacaaatattacccgttttggatttc
tgtaaagtatttcttatatcaggagtctctttggataactgtgttgaggttggacgaatt
gctaacacctacaatcttatagaagtggataaatatgttaataatttcatcctgaagaac
tttcctgctttattgagtactggggagtttctaaaactcccttttgaacgacttgcattt
gtgctttccagtaatagtcttaagcactgtaccgaacttgaactctttaaggcagcctgt
cgctggctaaggttggaagaccctcggatggattatgctgcaaagttaatgaagaatatt
cgatttccactgatgacaccacaggatctcatcaattacgtgcagacagtagatttcatg
agaacagacaatacctgcgtgaatttgcttttggaagctagcaattaccaaatgatgcca
tatatgcagccagtgatgcagtcagatagaactgccattcgatctgactccactcacttg
gttacattaggaggagttttgaggcagcagctggttgtcagtaaagaattacggatgtat
gatgaaagggcacaagaatggagatctttagccccaatggatgctccccgttaccagcat
ggtattgctgtcattggaaactttctttatgtagttggtggtcagagtaattatgataca
aaaggaaaaactgctgttgatacagttttcagatttgatcctcggtataataaatggatg
caggttgcatcattaaatgaaaagcgcacattctttcacttgagtgccctcaaaggacat
ttgtatgcagttggtgggcgcagtgcagctggtgaactggccacagtagaatgttacaac
ccaagaatgaatgagtggagctatgttgcaaaaatgagtgaaccccactatggtcatgct
ggaacagtatatggaggcttaatgtatatttcaggaggaattacccatgacactttccaa
aatgagctcatgtgttttgacccagatacagataaatggatgcaaaaggctccaatgact
acagtcagaggtctgcattgcatgtgtacagttggagataagctctatgtcattggtggc
aatcacttcagaggaacaagtgattatgatgatgttctaagctgtgaatactattcacca
acccttgaccagtggaccccaattgccgccatgttaagaggccaaagtgatgttggagtt
gccgtctttgaaaataaaatctatgttgttggtggatattcttggaataatcgttgtatg
gtagaaattgtccagaaatatgacccagaaaaagatgagtggcataaagtttttgatctt
ccagagtcacttggtggcattcgagcctgtacactcacagtttttccacctgaagaaaac
cctgggtcaccttctagagaatcacctctttcagcaccttcagatcattcttag

DBGET integrated database retrieval system