KEGG   Homo sapiens (human): 55958Help
Entry
55958             CDS       T01001                                 

Gene name
KLHL9
Definition
(RefSeq) kelch like family member 9
  KO
K10447  kelch-like protein 9/13
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    55958 (KLHL9)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     55958 (KLHL9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kelch_1 Kelch_6 BACK BTB Kelch_3 Kelch_2 Kelch_4 Kelch_5
Motif
Other DBs
NCBI-GeneID: 55958
NCBI-ProteinID: NP_061335
OMIM: 611201
HGNC: 18732
Ensembl: ENSG00000198642
Vega: OTTHUMG00000019669
Pharos: Q9P2J3(Tbio)
UniProt: Q9P2J3 Q58EZ4
Position
9p21.3
AA seq 617 aa AA seqDB search
MKVSLGNGEMGVSAHLQPCKAGTTRFFTSNTHSSVVLQGFDQLRIEGLLCDVTLVPGDGD
EIFPVHRAMMASASDYFKAMFTGGMKEQDLMCIKLHGVNKVGLKKIIDFIYTAKLSLNMD
NLQDTLEAASFLQILPVLDFCKVFLISGVSLDNCVEVGRIANTYNLIEVDKYVNNFILKN
FPALLSTGEFLKLPFERLAFVLSSNSLKHCTELELFKAACRWLRLEDPRMDYAAKLMKNI
RFPLMTPQDLINYVQTVDFMRTDNTCVNLLLEASNYQMMPYMQPVMQSDRTAIRSDSTHL
VTLGGVLRQQLVVSKELRMYDERAQEWRSLAPMDAPRYQHGIAVIGNFLYVVGGQSNYDT
KGKTAVDTVFRFDPRYNKWMQVASLNEKRTFFHLSALKGHLYAVGGRSAAGELATVECYN
PRMNEWSYVAKMSEPHYGHAGTVYGGLMYISGGITHDTFQNELMCFDPDTDKWMQKAPMT
TVRGLHCMCTVGDKLYVIGGNHFRGTSDYDDVLSCEYYSPTLDQWTPIAAMLRGQSDVGV
AVFENKIYVVGGYSWNNRCMVEIVQKYDPEKDEWHKVFDLPESLGGIRACTLTVFPPEEN
PGSPSRESPLSAPSDHS
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgtcccttggtaacggcgaaatgggcgtctctgcccatttgcagccttgtaag
gcaggaaccacacgcttttttaccagcaatactcacagttcggtggtattgcaaggcttt
gatcagcttagaatagaaggattgctttgtgatgtgaccctggtaccaggtgatggagat
gaaatcttccctgttcacagagctatgatggcgtctgctagtgattatttcaaagccatg
ttcacaggtggaatgaaagaacaagatttgatgtgcattaagcttcatggggtgaacaag
gttggtctgaagaaaatcattgattttatttatactgcaaaactttctcttaatatggac
aatcttcaggacacacttgaagctgctagctttttacaaatattacccgttttggatttc
tgtaaagtatttcttatatcaggagtctctttggataactgtgttgaggttggacgaatt
gctaacacctacaatcttatagaagtggataaatatgttaataatttcatcctgaagaac
tttcctgctttattgagtactggggagtttctaaaactcccttttgaacgacttgcattt
gtgctttccagtaatagtcttaagcactgtaccgaacttgaactctttaaggcagcctgt
cgctggctaaggttggaagaccctcggatggattatgctgcaaagttaatgaagaatatt
cgatttccactgatgacaccacaggatctcatcaattacgtgcagacagtagatttcatg
agaacagacaatacctgcgtgaatttgcttttggaagctagcaattaccaaatgatgcca
tatatgcagccagtgatgcagtcagatagaactgccattcgatctgactccactcacttg
gttacattaggaggagttttgaggcagcagctggttgtcagtaaagaattacggatgtat
gatgaaagggcacaagaatggagatctttagccccaatggatgctccccgttaccagcat
ggtattgctgtcattggaaactttctttatgtagttggtggtcagagtaattatgataca
aaaggaaaaactgctgttgatacagttttcagatttgatcctcggtataataaatggatg
caggttgcatcattaaatgaaaagcgcacattctttcacttgagtgccctcaaaggacat
ttgtatgcagttggtgggcgcagtgcagctggtgaactggccacagtagaatgttacaac
ccaagaatgaatgagtggagctatgttgcaaaaatgagtgaaccccactatggtcatgct
ggaacagtatatggaggcttaatgtatatttcaggaggaattacccatgacactttccaa
aatgagctcatgtgttttgacccagatacagataaatggatgcaaaaggctccaatgact
acagtcagaggtctgcattgcatgtgtacagttggagataagctctatgtcattggtggc
aatcacttcagaggaacaagtgattatgatgatgttctaagctgtgaatactattcacca
acccttgaccagtggaccccaattgccgccatgttaagaggccaaagtgatgttggagtt
gccgtctttgaaaataaaatctatgttgttggtggatattcttggaataatcgttgtatg
gtagaaattgtccagaaatatgacccagaaaaagatgagtggcataaagtttttgatctt
ccagagtcacttggtggcattcgagcctgtacactcacagtttttccacctgaagaaaac
cctgggtcaccttctagagaatcacctctttcagcaccttcagatcattcttag

DBGET integrated database retrieval system