KEGG   Homo sapiens (human): 5596Help
Entry
5596              CDS       T01001                                 

Gene name
MAPK4, ERK-4, ERK4, PRKM4, p63-MAPK, p63MAPK
Definition
mitogen-activated protein kinase 4 (EC:2.7.11.24)
Orthology
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     5596 (MAPK4)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   5596 (MAPK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
18q21.1
AA seq 376 aa AA seqDB search
MWAAGCILAEMLTGRMLFAGAHELEQMQLILETIPVIREEDKDELLRVMPSFVSSTWEVK
RPLRKLLPEVNSEAIDFLEKILTFNPMDRLTAEMGLQHPYMSPYSCPEDEPTSQHPFRIE
DEIDDIVLMAANQSQLSNWDTCSSRYPVSLSSDLEWRPDRCQDASEVQRDPRAGSAPLAE
DVQVDPRKDSHSSSERFLEQSHSSMERAFEADYGRSCDYKVGSPSYLDKLLWRDNKPHHY
SEPKLILDLSHWKQAAGAPPTATGLADTGAREDEPASLFLEIAQWVKSTQGGPEHASPPA
DDPERRLSASPPGRPAPVDGGASPQFDLDVFISRALKLCTKPEDLPDNKLGDLNGACIPE
HPGDLVQTEAFSKERW
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtgggccgccggctgcatcctggctgagatgcttacggggagaatgctctttgctggg
gcccatgagctggagcagatgcaactcatcctggagaccatccctgtaatccgggaggaa
gacaaggacgagctgctcagggtgatgccttcctttgtcagcagcacctgggaggtgaag
aggcctctgcgcaagctgctccctgaagtgaacagtgaagccatcgactttctggagaag
atcctgacctttaaccccatggatcgcctaacagctgagatggggctgcaacacccctac
atgagcccatactcgtgccctgaggacgagcccacctcacaacaccccttccgcattgag
gatgagatcgacgacatcgtgctgatggccgctaaccagagccagctgtccaactgggac
acgtgcagttccaggtaccctgtgagcctgtcgtcggacctggagtggcggcctgaccgg
tgccaggacgccagcgaggtacagcgcgacccgcgcgcgggttcggcgccactggctgag
gacgtgcaggtggacccgcgcaaggactcgcacagcagctccgagcgcttcctagagcag
tcgcactcgtccatggagcgcgccttcgaggccgactacgggcgctcctgcgactacaag
gtggggtcgccgtcctacctggacaagctgctgtggcgcgacaacaagccgcaccactac
tcggagcccaagctcatcctggacctgtcgcactggaagcaggcggccggcgcgcccccc
acggccacggggctggcggacacgggggcgcgcgaggacgagccggccagcctcttcctg
gagatcgcgcagtgggtcaagagcacgcagggcggcccagagcacgccagcccgcccgcc
gacgaccccgagcgccgcttgtctgcctcgccccccggccgcccggccccggtggacggc
ggcgccagcccccagttcgacctggacgtgttcatctcccgcgccctgaagctctgcacc
aagcccgaggacctgccggacaataaactgggcgacctcaatggtgcgtgcatccccgag
caccctggcgacctcgtgcagaccgaggccttctccaaagaaaggtggtga

DBGET integrated database retrieval system