KEGG   Homo sapiens (human): 55968Help
Entry
55968             CDS       T01001                                 

Gene name
NSFL1C, P47, UBX1, UBXD10, UBXN2C, dJ776F14.1
Definition
(RefSeq) NSFL1 cofactor
  KO
K14012  
UBX domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    55968 (NSFL1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20p13
AA seq 370 aa AA seqDB search
MAAERQEALREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDGGDEDIVTISQATPSS
VSRGTAPSDNRVTSFRDLIHDQDEDEEEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVD
DLFKGAKEHGAVAVERVTKSPGETSKPRPFAGGGYRLGAAPEEESAYVAGEKRQHSSQDV
HVVLKLWKSGFSLDNGELRSYQDPSNAQFLESIRRGEVPAELRRLAHGGQVNLDMEDHRD
EDFVKPKGAFKAFTGEGQKLGSTAPQVLSTSSPAQQAENEAKASSSILIDESEPTTNIQI
RLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSFILMTTFPNKELADESQTLKEANL
LNAVIVQRLT
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggagcgacaggaggcgctgagggagttcgtggcggtgacgggcgccgaggag
gaccgggcccgcttctttctcgagtcggccggctgggacttgcagatcgcgctagcgagc
ttttatgaggacggaggggatgaagacattgtgaccatttcgcaggcaacccccagttca
gtgtccagaggcacagcccccagtgataatagagtgacatccttcagagacctcattcat
gaccaagatgaagatgaggaggaagaggaaggccagaggttttatgctgggggctcagag
agaagtggacagcagattgttggccctcccaggaagaaaagtcccaacgagctggtggat
gatctctttaaaggtgccaaagagcatggagctgtagctgtggagcgagtgaccaagagc
cctggagagaccagtaaaccgagaccatttgcaggaggtggctaccgccttggggcagca
ccagaggaagagtctgcctatgtggcaggagaaaagaggcagcattccagccaagatgtt
catgtagtattgaaactctggaagagtggattcagcctggataatggagaactcagaagc
taccaagacccatccaatgcccagtttctggagtctatccgcagaggggaggtgccagca
gagcttcggaggctagctcacggtggacaggtgaacttggatatggaggaccatcgggac
gaggactttgtgaagcccaaaggagccttcaaagccttcactggcgagggtcagaaactg
ggcagcactgccccccaggtgttgagtaccagctctccagcccaacaggcagaaaatgaa
gccaaagccagctcttccatcttaatcgacgaatcagagcctaccacaaacatccaaatt
cggcttgcagacggcgggaggctggtgcagaaatttaaccacagccacaggatcagcgac
atccgactcttcatcgtggatgcccggccagccatggctgccaccagctttatcctcatg
actactttcccgaacaaagagctggctgatgagagccagaccctgaaggaagccaacctg
ctcaatgctgtcatcgtgcagcggttaacataa

DBGET integrated database retrieval system