KEGG   Homo sapiens (human): 55968Help
Entry
55968             CDS       T01001                                 

Gene name
NSFL1C, P47, UBX1, UBXD10, UBXN2C, dJ776F14.1
Definition
NSFL1 (p97) cofactor (p47)
Orthology
K14012  
UBX domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:hsa04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20p13
AA seq 372 aa AA seqDB search
MAAERQEALREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDGGDEDIVTISQATPSS
VSRGTAPSDNRVTSFRDLIHDQDEDEEEEEGQRSRFYAGGSERSGQQIVGPPRKKSPNEL
VDDLFKGAKEHGAVAVERVTKSPGETSKPRPFAGGGYRLGAAPEEESAYVAGEKRQHSSQ
DVHVVLKLWKSGFSLDNGELRSYQDPSNAQFLESIRRGEVPAELRRLAHGGQVNLDMEDH
RDEDFVKPKGAFKAFTGEGQKLGSTAPQVLSTSSPAQQAENEAKASSSILIDESEPTTNI
QIRLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSFILMTTFPNKELADESQTLKEA
NLLNAVIVQRLT
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggagcgacaggaggcgctgagggagttcgtggcggtgacgggcgccgaggag
gaccgggcccgcttctttctcgagtcggccggctgggacttgcagatcgcgctagcgagc
ttttatgaggacggaggggatgaagacattgtgaccatttcgcaggcaacccccagttca
gtgtccagaggcacagcccccagtgataatagagtgacatccttcagagacctcattcat
gaccaagatgaagatgaggaggaagaggaaggccagaggagcaggttttatgctgggggc
tcagagagaagtggacagcagattgttggccctcccaggaagaaaagtcccaacgagctg
gtggatgatctctttaaaggtgccaaagagcatggagctgtagctgtggagcgagtgacc
aagagccctggagagaccagtaaaccgagaccatttgcaggaggtggctaccgccttggg
gcagcaccagaggaagagtctgcctatgtggcaggagaaaagaggcagcattccagccaa
gatgttcatgtagtattgaaactctggaagagtggattcagcctggataatggagaactc
agaagctaccaagacccatccaatgcccagtttctggagtctatccgcagaggggaggtg
ccagcagagcttcggaggctagctcacggtggacaggtgaacttggatatggaggaccat
cgggacgaggactttgtgaagcccaaaggagccttcaaagccttcactggcgagggtcag
aaactgggcagcactgccccccaggtgttgagtaccagctctccagcccaacaggcagaa
aatgaagccaaagccagctcttccatcttaatcgacgaatcagagcctaccacaaacatc
caaattcggcttgcagacggcgggaggctggtgcagaaatttaaccacagccacaggatc
agcgacatccgactcttcatcgtggatgcccggccagccatggctgccaccagctttatc
ctcatgactactttcccgaacaaagagctggctgatgagagccagaccctgaaggaagcc
aacctgctcaatgctgtcatcgtgcagcggttaacataa

DBGET integrated database retrieval system