KEGG   Homo sapiens (human): 55970Help
Entry
55970             CDS       T01001                                 

Gene name
GNG12
Definition
guanine nucleotide binding protein (G protein), gamma 12
Orthology
K04347  
guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Chemokine signaling pathway
PI3K-Akt signaling pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Regulation of actin cytoskeleton
Morphine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    55970 (GNG12)
   04010 MAPK signaling pathway
    55970 (GNG12)
   04151 PI3K-Akt signaling pathway
    55970 (GNG12)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    55970 (GNG12)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    55970 (GNG12)
  Nervous system
   04724 Glutamatergic synapse
    55970 (GNG12)
   04727 GABAergic synapse
    55970 (GNG12)
   04725 Cholinergic synapse
    55970 (GNG12)
   04728 Dopaminergic synapse
    55970 (GNG12)
   04726 Serotonergic synapse
    55970 (GNG12)
   04723 Retrograde endocannabinoid signaling
    55970 (GNG12)
  Environmental adaptation
   04713 Circadian entrainment
    55970 (GNG12)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    55970 (GNG12)
   05034 Alcoholism
    55970 (GNG12)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   55970 (GNG12)
  Exosomal proteins of colorectal cancer cells
   55970 (GNG12)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    55970 (GNG12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p31.3
AA seq 72 aa AA seqDB search
MSSKTASTNNIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLIGIPTSE
NPFKDKKTCIIL
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcaaaacagcaagcaccaacaatatagcccaggcaaggagaactgtgcagcag
ttaagattagaagcctccattgaaagaataaaggtttcgaaggcatcagcggacctcatg
tcctactgtgaggaacatgccaggagtgaccctttgctgataggaataccaacttcagaa
aaccctttcaaggataaaaaaacttgcatcatcttatag

DBGET integrated database retrieval system