KEGG   Homo sapiens (human): 55998Help
Entry
55998             CDS       T01001                                 

Gene name
NXF5
Definition
(RefSeq) nuclear RNA export factor 5
  KO
K14284  
nuclear RNA export factor
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
mRNA surveillance pathway
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    55998 (NXF5)
   03015 mRNA surveillance pathway
    55998 (NXF5)
   03008 Ribosome biogenesis in eukaryotes
    55998 (NXF5)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    55998 (NXF5)
   05168 Herpes simplex infection
    55998 (NXF5)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     55998 (NXF5)
   mRNA cycle factors
    Stress granule specific factors
     55998 (NXF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq22
AA seq 365 aa AA seqDB search
MRRNTQDENMRKWFKVTIPYGIKYDKAWLMNSIQSNCSVPFTPVDFHYIRNRACFFVQVA
SAASALKDVSYKIYDDENQKICIFVSHFTAPYSVKNKLKPGQMEMLKLTMNKRYNVSQQA
LDLQNLRFDPDLMGRDIDIILNRRNCMAATLKITERNFPELLSLNLCNNKLYQLDGLSDI
TEKAPKVKTLNLSKNKLESAWELGKVKGLKLEELWLEGNPLCSTFSDQSAYVSAIRDCFP
KLLRLDGRELSAPVIVDIDSSETMKPCKENFTGSETLKHLVLQFLQQSNLCKYFKDSRNI
KILKDPYLQRKLLKHTKCPRNVDSLSALPETQHDFTSILVDMWYQTVNTCFLPRAGPESQ
SLRPL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaggcggaacacacaagatgaaaacatgaggaaatggttcaaggtcacaattccttat
gggataaagtatgacaaggcatggctaatgaattcaatccagagcaattgcagtgtcccc
ttcactccggttgatttccactacatccgaaatcgggcatgcttctttgtccaggttgct
agtgctgcctctgcattgaaggatgtcagttataagatttatgatgatgagaaccaaaag
atatgtatatttgtcagtcattttactgcgccctactctgtgaagaataagttgaagcca
ggccaaatggagatgctaaagctgaccatgaacaaacggtacaatgtctcccagcaagct
cttgatctccagaatctccgctttgacccagacttgatgggccgtgacattgatataatc
ctgaatcgaagaaactgcatggctgccaccctgaagatcactgaaagaaatttccctgag
ctgttgtctttgaacttgtgcaacaacaaactgtaccagctggatggcctttctgacatt
acagagaaggctcccaaagtcaagaccctgaatctctccaaaaataagctggagtcggcg
tgggagttgggcaaggtgaaagggctgaagctcgaagagctatggctagaagggaacccg
ttgtgcagcaccttctcggaccagtctgcctatgtaagtgccatccgggattgtttcccc
aagttgttacgcctggacggccgagagttatccgcaccagtgattgttgacattgacagc
tctgagacaatgaaaccctgcaaggaaaactttactggatctgagaccctaaagcattta
gtcctgcaattcctgcagcagagcaacttgtgcaagtacttcaaggatagcaggaatata
aaaattctcaaagacccctacctgcagaggaagctgctaaagcacacaaaatgtccacga
aacgtggactccctcagtgcattgcctgaaactcagcatgacttcacctccatcctggtg
gacatgtggtaccagaccgtgaacacctgcttcctccctcgggcaggcccagagagccag
agcctaagaccactctaa

DBGET integrated database retrieval system