KEGG   Homo sapiens (human): 55998Help
Entry
55998             CDS       T01001                                 

Gene name
NXF5
Definition
nuclear RNA export factor 5
Orthology
K14284  
nuclear RNA export factor 1/2
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
mRNA surveillance pathway
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    55998 (NXF5)
   03015 mRNA surveillance pathway
    55998 (NXF5)
   03008 Ribosome biogenesis in eukaryotes
    55998 (NXF5)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    55998 (NXF5)
   05168 Herpes simplex infection
    55998 (NXF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq22
AA seq 365 aa AA seqDB search
MRRNTQDENMRKWFKVTIPYGIKYDKAWLMNSIQSNCSVPFTPVDFHYIRNRACFFVQVA
SAASALKDVSYKIYDDENQKICIFVSHFTAPYSVKNKLKPGQMEMLKLTMNKRYNVSQQA
LDLQNLRFDPDLMGRDIDIILNRRNCMAATLKITERNFPELLSLNLCNNKLYQLDGLSDI
TEKAPKVKTLNLSKNKLESAWELGKVKGLKLEELWLEGNPLCSTFSDQSAYVSAIRDCFP
KLLRLDGRELSAPVIVDIDSSETMKPCKENFTGSETLKHLVLQFLQQSNLCKYFKDSRNI
KILKDPYLQRKLLKHTKCPRNVDSLSALPETQHDFTSILVDMWYQTVNTCFLPRAGPESQ
SLRPL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaggcggaacacacaagatgaaaacatgaggaaatggttcaaggtcacaattccttat
gggataaagtatgacaaggcatggctaatgaattcaatccagagcaattgcagtgtcccc
ttcactccggttgatttccactacatccgaaatcgggcatgcttctttgtccaggttgct
agtgctgcctctgcattgaaggatgtcagttataagatttatgatgatgagaaccaaaag
atatgtatatttgtcagtcattttactgcgccctactctgtgaagaataagttgaagcca
ggccaaatggagatgctaaagctgaccatgaacaaacggtacaatgtctcccagcaagct
cttgatctccagaatctccgctttgacccagacttgatgggccgtgacattgatataatc
ctgaatcgaagaaactgcatggctgccaccctgaagatcactgaaagaaatttccctgag
ctgttgtctttgaacttgtgcaacaacaaactgtaccagctggatggcctttctgacatt
acagagaaggctcccaaagtcaagaccctgaatctctccaaaaataagctggagtcggcg
tgggagttgggcaaggtgaaagggctgaagctcgaagagctatggctagaagggaacccg
ttgtgcagcaccttctcggaccagtctgcctatgtaagtgccatccgggattgtttcccc
aagttgttacgcctggacggccgagagttatccgcaccagtgattgttgacattgacagc
tctgagacaatgaaaccctgcaaggaaaactttactggatctgagaccctaaagcattta
gtcctgcaattcctgcagcagagcaacttgtgcaagtacttcaaggatagcaggaatata
aaaattctcaaagacccctacctgcagaggaagctgctaaagcacacaaaatgtccacga
aacgtggactccctcagtgcattgcctgaaactcagcatgacttcacctccatcctggtg
gacatgtggtaccagaccgtgaacacctgcttcctccctcgggcaggcccagagagccag
agcctaagaccactctaa

DBGET integrated database retrieval system