KEGG   Homo sapiens (human): 55998Help
Entry
55998             CDS       T01001                                 

Gene name
NXF5
Definition
nuclear RNA export factor 5
Orthology
K14284  
nuclear RNA export factor 1/2
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
mRNA surveillance pathway
Influenza A
Herpes simplex infection
Class
Genetic Information Processing; Translation; RNA transport [PATH:hsa03013]
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:hsa03015]
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:hsa03008]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq22
AA seq 365 aa AA seqDB search
MRRNTQDENMRKWFKVTIPYGIKYDKAWLMNSIQSNCSVPFTPVDFHYIRNRACFFVQVA
SAASALKDVSYKIYDDENQKICIFVSHFTAPYSVKNKLKPGQMEMLKLTMNKRYNVSQQA
LDLQNLRFDPDLMGRDIDIILNRRNCMAATLKITERNFPELLSLNLCNNKLYQLDGLSDI
TEKAPKVKTLNLSKNKLESAWELGKVKGLKLEELWLEGNPLCSTFSDQSAYVSAIRDCFP
KLLRLDGRELSAPVIVDIDSSETMKPCKENFTGSETLKHLVLQFLQQSNLCKYFKDSRNI
KILKDPYLQRKLLKHTKCPRNVDSLSALPETQHDFTSILVDMWYQTVNTCFLPRAGPESQ
SLRPL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaggcggaacacacaagatgaaaacatgaggaaatggttcaaggtcacaattccttat
gggataaagtatgacaaggcatggctaatgaattcaatccagagcaattgcagtgtcccc
ttcactccggttgatttccactacatccgaaatcgggcatgcttctttgtccaggttgct
agtgctgcctctgcattgaaggatgtcagttataagatttatgatgatgagaaccaaaag
atatgtatatttgtcagtcattttactgcgccctactctgtgaagaataagttgaagcca
ggccaaatggagatgctaaagctgaccatgaacaaacggtacaatgtctcccagcaagct
cttgatctccagaatctccgctttgacccagacttgatgggccgtgacattgatataatc
ctgaatcgaagaaactgcatggctgccaccctgaagatcactgaaagaaatttccctgag
ctgttgtctttgaacttgtgcaacaacaaactgtaccagctggatggcctttctgacatt
acagagaaggctcccaaagtcaagaccctgaatctctccaaaaataagctggagtcggcg
tgggagttgggcaaggtgaaagggctgaagctcgaagagctatggctagaagggaacccg
ttgtgcagcaccttctcggaccagtctgcctatgtaagtgccatccgggattgtttcccc
aagttgttacgcctggacggccgagagttatccgcaccagtgattgttgacattgacagc
tctgagacaatgaaaccctgcaaggaaaactttactggatctgagaccctaaagcattta
gtcctgcaattcctgcagcagagcaacttgtgcaagtacttcaaggatagcaggaatata
aaaattctcaaagacccctacctgcagaggaagctgctaaagcacacaaaatgtccacga
aacgtggactccctcagtgcattgcctgaaactcagcatgacttcacctccatcctggtg
gacatgtggtaccagaccgtgaacacctgcttcctccctcgggcaggcccagagagccag
agcctaagaccactctaa

DBGET integrated database retrieval system