KEGG   Homo sapiens (human): 56000Help
Entry
56000             CDS       T01001                                 

Gene name
NXF3
Definition
nuclear RNA export factor 3
Orthology
K14284  
nuclear RNA export factor
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
mRNA surveillance pathway
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    56000 (NXF3)
   03015 mRNA surveillance pathway
    56000 (NXF3)
   03008 Ribosome biogenesis in eukaryotes
    56000 (NXF3)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    56000 (NXF3)
   05168 Herpes simplex infection
    56000 (NXF3)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     56000 (NXF3)
   mRNA cycle factors
    Stress granule specific factors
     56000 (NXF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq22
AA seq 531 aa AA seqDB search
MSLPSGHTTGHTDQVVQRRARCWDIYQRRFSSRSEPVNPGMHSSSHQQQDGDAAMHGAHM
DSPVRYTPYTISPYNRKGSFRKQDQTHVNMEREQKPPERRMEGNMPDGTLGSWFKITVPF
GIKYNEKWLLNLIQNECSVPFVPVEFHYENMHASFFVENASIAYALKNVSGKIWDEDNEK
ISIFVNPAGIPHFVHRELKSEKVEQIKLAMNQQCDVSQEALDIQRLPFYPDMVNRDTKMA
SNPRKCMAASLDVHEENIPTVMSAGEMDKWKGIEPGEKCADRSPVCTTFSDTSSNINSIL
ELFPKLLCLDGQQSPRATLCGTEAHKRLPTCKGSFFGSEMLKNLVLQFLQQYYLIYDSGD
RQGLLSAYHDEACFSLSIPFNPEDSAPSSFCKFFKDSRNIKILKDPYLRGELLKHTKLDI
VDSLSALPKTQHDLSSFLVDMWYQTEWMLCFSVNGVFKEVEGQSQGSVLAFTRTFIATPG
SSSSLCIVNDKLFVRDTSHQGTQSALFTLVPTAFSSSVPAFSQEQQKMLPS
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgccttcaggacacactacgggtcacactgatcaagttgttcaaagaagagca
agatgttgggatatttaccaaaggagatttagcagtaggtctgaacctgtcaatcctggc
atgcattcttcatcccatcagcagcaagatggagatgcagcaatgcatggtgcccacatg
gactctccagtaagatacactccctatactatttcaccctataatcggaaaggcagtttt
cgtaaacaagaccaaacccacgttaacatggagagagagcaaaaacctccagagagaaga
atggaggggaacatgccggatgggaccttagggagctggttcaagatcacagttcccttt
ggcataaaatacaatgagaagtggctgctgaatttgattcagaatgaatgcagtgtaccc
ttcgtcccagttgagtttcactatgaaaacatgcatgccagcttctttgtggagaatgcc
agcatcgcctatgcactgaagaatgtcagtggcaagatttgggatgaggataatgaaaag
atatcaatctttgtcaaccctgctggcataccccactttgtgcacagggagctgaagtca
gaaaaggtggagcagataaagctggccatgaaccaacagtgtgatgtctcccaggaagct
cttgatatccagagactcccattttacccagacatggtgaaccgtgatactaagatggca
tcgaatcctagaaagtgcatggctgcctccctggacgtccatgaagagaacatacctaca
gtgatgtctgcaggggagatggacaagtggaaagggatagagccaggagagaagtgtgcg
gacagaagcccagtgtgcacgaccttctcggatacctccagcaacataaactccatcctg
gaattgttccccaaattattatgcctggatggccagcagtcacccagagcaactttatgt
ggtactgaagcccacaagaggttaccaacctgtaagggaagcttctttggatctgagatg
ttgaagaatctggtcctgcaattcctgcagcagtattacttgatctatgactctggagat
cgacagggtctccttagtgcttaccacgatgaggcctgcttctccctgagcattcccttc
aatcctgaggactcagccccgagcagcttctgcaagttcttcaaggatagcaggaatata
aaaattctcaaggacccctaccttcggggggagctgctgaagcacacaaaacttgatatt
gtggactccctcagtgcgttgcctaaaactcagcatgacctcagctccttcctggtggac
atgtggtaccagacggaatggatgctctgcttttctgtcaacggggtgttcaaggaagtg
gaaggacagtctcagggttctgttctcgccttcacccggaccttcattgctacccctggc
agcagttccagtctgtgcatcgtgaatgacaagctctttgtgcgggataccagccaccaa
gggacccagagtgccttgttcaccctagtgcccacagccttctccagctccgtgcctgcc
ttctcccaggagcagcagaaaatgctgccttcgtaa

DBGET integrated database retrieval system