KEGG   Homo sapiens (human): 56001Help
Entry
56001             CDS       T01001                                 

Gene name
NXF2, CT39, TAPL-2, TCP11X2
Definition
(RefSeq) nuclear RNA export factor 2
  KO
K14284  
nuclear RNA export factor
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
mRNA surveillance pathway
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    56001 (NXF2)
   03015 mRNA surveillance pathway
    56001 (NXF2)
   03008 Ribosome biogenesis in eukaryotes
    56001 (NXF2)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    56001 (NXF2)
   05168 Herpes simplex infection
    56001 (NXF2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     56001 (NXF2)
   mRNA cycle factors
    Stress granule specific factors
     56001 (NXF2)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    56001 (NXF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq22.1
AA seq 626 aa AA seqDB search
MCSTLKKCGTYRTEVAECHDHGSTFQGRKKGGSSFRDNFDKRSCHYEHGGYERPPSHCQE
NDGSVEMRDVHKDQQLRHTPYSIRCERRMKWHSEDEIRITTWRNRKPPERKMSQNTQDGY
TRNWFKVTIPYGIKYDKAWLMNSIQSHCSDRFTPVDFHYVRNRACFFVQDASAASALKDV
SYKIYDDENQKICIFVNHSTAPYSVKNKLKPGQMEMLKLTMNKRYNVSQQALDLQNLRFD
PDLMGRDIDIILNRRNCMAATLKIIERNFPELLSLNLCNNKLYQLDGLSDITEKAPKVKT
LNLSKNKLESAWELGKVKGLKLEELWLEGNPLCSTFSDQSAYVSAIRDCFPKLLRLDGRE
LSAPVIVDIDSSETMKPCKENFTGSETLKHLVLQFLQQYYSIYDSGDRQGLLGAYHDEAC
FSLAIPFDPKDSAPSSLCKYFEDSRNMKTLKDPYLKGELLRRTKRDIVDSLSALPKTQHD
LSSILVDVWCQTERMLCFSVNGVFKEVEGQSQGSVLAFTRTFIATPGSSSSLCIVNDELF
VRDASPQETQSAFSIPVSTLSSSSEPSLSQEQQEMVQAFSAQSGMKLEWSQKCLQDNEWN
YTRAGQAFTMLQTEGKIPAEAFKQIS
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgtgctctactctaaagaagtgtgggacatacagaactgaagttgcagaatgccatgac
catggtagcacttttcaaggaagaaagaaaggtgggagttctttccgggataattttgac
aagaggagctgtcattatgaacatggtgggtatgagcgcccgccttcacactgccaggag
aatgatggaagcgtggagatgagggatgtccacaaggaccaacaactaagacacactcct
tatagcatccgatgcgaaagaagaatgaaatggcatagtgaagacgaaatccgtattacc
acgtggagaaatagaaaacctccggagagaaaaatgagtcagaacacacaggatggatac
acaaggaactggtttaaggtcacaattccttacgggataaagtatgacaaggcatggcta
atgaattcaatccagagccattgcagtgaccgcttcactccggttgatttccactacgtc
cgaaatcgggcatgcttctttgtccaggatgctagcgctgcctccgcattgaaggatgtc
agttataagatttatgatgatgagaaccaaaagatatgtatatttgtcaatcattctact
gcgccctactctgtgaagaataagttgaagccaggccaaatggagatgctaaagctgacc
atgaacaaacggtacaatgtctcccagcaagctcttgatctccagaatctccgctttgac
ccagacttgatgggccgtgacattgatataatcctgaatcgaagaaactgcatggctgcc
accctgaagatcattgaaagaaatttccctgagctgttgtctttgaacttgtgcaacaac
aagctgtaccagctggatggcctttctgacattacagagaaggctcccaaagtcaagacc
ctgaatctctccaaaaataagctggagtcggcgtgggagttgggcaaggtgaaagggctg
aagctcgaagagctatggctagaagggaacccgttgtgcagcaccttctcggaccagtcc
gcctatgtaagtgccatccgggattgtttccccaagttgttacgcctggacggccgagag
ttatccgcaccagtgattgttgacattgacagctctgagacaatgaaaccctgcaaggaa
aactttactggatctgagaccctaaagcatttagtcctgcaattcctgcagcagtattac
tcgatctatgactctggagatcgacagggtctcctcggtgcttaccacgatgaggcctgc
ttctccttggctattcccttcgaccccaaggactcagccccgagcagcttgtgcaagtac
tttgaggatagcaggaatatgaaaacactcaaggacccctacctgaagggggaactgctg
aggcgcacaaaacgtgacattgtggactccctcagtgcgttgcccaaaactcagcatgac
ctcagctccatcctggtggacgtgtggtgccagacggaaaggatgctctgcttttctgtc
aatggggttttcaaggaagtggaaggacagtctcagggttctgttctcgccttcacccgg
accttcattgctacccctggcagcagttccagtctgtgcatcgtgaatgacgagctgttt
gtgagggatgccagcccccaagagactcagagtgccttctccatcccagtgtccacactc
tcctccagctctgagccctccctctcccaggagcagcaggaaatggtgcaggctttctct
gcccagtctgggatgaaactggagtggtctcagaagtgccttcaggacaatgagtggaac
tacactagagctggccaggccttcactatgctccagaccgagggcaagatccccgcggag
gccttcaagcaaatctcctaa

DBGET integrated database retrieval system