KEGG   Homo sapiens (human): 56034Help
Entry
56034             CDS       T01001                                 

Gene name
PDGFC, FALLOTEIN, SCDGF
Definition
platelet derived growth factor C
Orthology
K05450  
platelet derived growth factor C/D
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Focal adhesion
Gap junction
Regulation of actin cytoskeleton
Prostate cancer
Melanoma
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Cellular Processes; Cell communication; Gap junction [PATH:hsa04540]
Human Diseases; Cancers; Melanoma [PATH:hsa05218]
Human Diseases; Cancers; Prostate cancer [PATH:hsa05215]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
4q32
AA seq 345 aa AA seqDB search
MSLFGLLLLTSALAGQRQGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHS
PRFPHTYPRNTVLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTIL
GRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSVLPPSA
LPLDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNL
LTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSK
VTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcttcgggcttctcctgctgacatctgccctggccggccagagacaggggact
caggcggaatccaacctgagtagtaaattccagttttccagcaacaaggaacagaacgga
gtacaagatcctcagcatgagagaattattactgtgtctactaatggaagtattcacagc
ccaaggtttcctcatacttatccaagaaatacggtcttggtatggagattagtagcagta
gaggaaaatgtatggatacaacttacgtttgatgaaagatttgggcttgaagacccagaa
gatgacatatgcaagtatgattttgtagaagttgaggaacccagtgatggaactatatta
gggcgctggtgtggttctggtactgtaccaggaaaacagatttctaaaggaaatcaaatt
aggataagatttgtatctgatgaatattttccttctgaaccagggttctgcatccactac
aacattgtcatgccacaattcacagaagctgtgagtccttcagtgctacccccttcagct
ttgccactggacctgcttaataatgctataactgcctttagtaccttggaagaccttatt
cgatatcttgaaccagagagatggcagttggacttagaagatctatataggccaacttgg
caacttcttggcaaggcttttgtttttggaagaaaatccagagtggtggatctgaacctt
ctaacagaggaggtaagattatacagctgcacacctcgtaacttctcagtgtccataagg
gaagaactaaagagaaccgataccattttctggccaggttgtctcctggttaaacgctgt
ggtgggaactgtgcctgttgtctccacaattgcaatgaatgtcaatgtgtcccaagcaaa
gttactaaaaaataccacgaggtccttcagttgagaccaaagaccggtgtcaggggattg
cacaaatcactcaccgacgtggccctggagcaccatgaggagtgtgactgtgtgtgcaga
gggagcacaggaggatag

DBGET integrated database retrieval system