KEGG   Homo sapiens (human): 56034Help
Entry
56034             CDS       T01001                                 

Gene name
PDGFC, FALLOTEIN, SCDGF
Definition
platelet derived growth factor C
Orthology
K05450  
platelet derived growth factor C/D
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Focal adhesion
Gap junction
Regulation of actin cytoskeleton
Prostate cancer
Melanoma
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    56034 (PDGFC)
   04015 Rap1 signaling pathway
    56034 (PDGFC)
   04151 PI3K-Akt signaling pathway
    56034 (PDGFC)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    56034 (PDGFC)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    56034 (PDGFC)
  Cellular commiunity
   04510 Focal adhesion
    56034 (PDGFC)
   04540 Gap junction
    56034 (PDGFC)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    56034 (PDGFC)
   05218 Melanoma
    56034 (PDGFC)
   05215 Prostate cancer
    56034 (PDGFC)
Cytokines [BR:hsa04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass I
    56034 (PDGFC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
4q32
AA seq 345 aa AA seqDB search
MSLFGLLLLTSALAGQRQGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHS
PRFPHTYPRNTVLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTIL
GRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSVLPPSA
LPLDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNL
LTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSK
VTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcttcgggcttctcctgctgacatctgccctggccggccagagacaggggact
caggcggaatccaacctgagtagtaaattccagttttccagcaacaaggaacagaacgga
gtacaagatcctcagcatgagagaattattactgtgtctactaatggaagtattcacagc
ccaaggtttcctcatacttatccaagaaatacggtcttggtatggagattagtagcagta
gaggaaaatgtatggatacaacttacgtttgatgaaagatttgggcttgaagacccagaa
gatgacatatgcaagtatgattttgtagaagttgaggaacccagtgatggaactatatta
gggcgctggtgtggttctggtactgtaccaggaaaacagatttctaaaggaaatcaaatt
aggataagatttgtatctgatgaatattttccttctgaaccagggttctgcatccactac
aacattgtcatgccacaattcacagaagctgtgagtccttcagtgctacccccttcagct
ttgccactggacctgcttaataatgctataactgcctttagtaccttggaagaccttatt
cgatatcttgaaccagagagatggcagttggacttagaagatctatataggccaacttgg
caacttcttggcaaggcttttgtttttggaagaaaatccagagtggtggatctgaacctt
ctaacagaggaggtaagattatacagctgcacacctcgtaacttctcagtgtccataagg
gaagaactaaagagaaccgataccattttctggccaggttgtctcctggttaaacgctgt
ggtgggaactgtgcctgttgtctccacaattgcaatgaatgtcaatgtgtcccaagcaaa
gttactaaaaaataccacgaggtccttcagttgagaccaaagaccggtgtcaggggattg
cacaaatcactcaccgacgtggccctggagcaccatgaggagtgtgactgtgtgtgcaga
gggagcacaggaggatag

DBGET integrated database retrieval system