KEGG   Homo sapiens (human): 56052Help
Entry
56052             CDS       T01001                                 

Gene name
ALG1, CDG1K, HMAT1, HMT-1, HMT1, MT-1, Mat-1, hMat-1
Definition
(RefSeq) ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase
  KO
K03842  beta-1,4-mannosyltransferase [EC:2.4.1.142]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00510  N-Glycan biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00055  N-glycan precursor biosynthesis
Disease
H00118  Congenital disorders of glycosylation (CDG) type I
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    56052 (ALG1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.142  chitobiosyldiphosphodolichol beta-mannosyltransferase
     56052 (ALG1)
Glycosyltransferases [BR:hsa01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   56052 (ALG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4 Glyco_trans_1_2
Motif
Other DBs
NCBI-GeneID: 56052
NCBI-ProteinID: NP_061982
OMIM: 605907
HGNC: 18294
Ensembl: ENSG00000033011
Vega: OTTHUMG00000129529
Pharos: Q9BT22(Tbio)
UniProt: Q9BT22
Position
16p13.3
AA seq 464 aa AA seqDB search
MAASCLVLLALCLLLPLLLLGGWKRWRRGRAARHVVAVVLGDVGRSPRMQYHALSLAMHG
FSVTLLGFCNSKPHDELLQNNRIQIVGLTELQSLAVGPRVFQYGVKVVLQAMYLLWKLMW
REPGAYIFLQNPPGLPSIAVCWFVGCLCGSKLVIDWHNYGYSIMGLVHGPNHPLVLLAKW
YEKFFGRLSHLNLCVTNAMREDLADNWHIRAVTVYDKPASFFKETPLDLQHRLFMKLGSM
HSPFRARSEPEDPVTERSAFTERDAGSGLVTRLRERPALLVSSTSWTEDEDFSILLAALE
KFEQLTLDGHNLPSLVCVITGKGPLREYYSRLIHQKHFQHIQVCTPWLEAEDYPLLLGSA
DLGVCLHTSSSGLDLPMKVVDMFGCCLPVCAVNFKCLHELVKHEENGLVFEDSEELAAQL
QMLFSNFPDPAGKLNQFRKNLRESQQLRWDESWVQTVLPLVMDT
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctcatgcttggtcctgctggcgctgtgtctgctgctgccgctgctgctgctg
ggaggatggaagcgctggcgccgggggcgggcggcccggcatgtagtagcggtggtgctg
ggcgacgtgggccgcagcccccgtatgcagtaccacgcgctgtcgttggccatgcacggc
ttctcggtgaccctcctggggttctgcaactccaaaccccatgatgagctcttgcagaac
aacagaattcagattgtggggttgacagaacttcagagtcttgcagttgggccccgagtt
ttccagtacggagtcaaagttgtacttcaggctatgtacttgctgtggaagttgatgtgg
agggagccaggtgcctatatctttctccagaaccccccaggtctgcctagcattgctgtc
tgctggttcgtgggctgcctttgtggaagcaagctcgtcattgactggcacaactatggc
tactccatcatgggtctggtgcatggccccaaccatcccctcgttctgctggccaagtgg
tacgagaagttctttgggcgcctgtcccacctgaacctgtgtgttaccaatgctatgcga
gaagacctggcggataactggcacatcagggctgtgaccgtctacgacaagcccgcatct
ttctttaaagagacacctctggacctgcagcaccggctcttcatgaagctgggcagcatg
cactctccgttcagggcccgctcagaacctgaggacccagtcacggagcggtcggccttc
acggagcgggatgctgggagcgggctggtgacgcgtctccgtgagcggccagccctgctg
gtcagcagcacgagctggacagaggacgaagacttctccatcctgctggcagctttagaa
aagtttgaacaactgactcttgatggacacaaccttccttctctcgtctgtgtgataaca
ggcaaagggcctctgagggagtattatagccgcctcatccaccagaagcacttccagcac
atccaggtctgcaccccctggctggaggccgaggactaccccctgcttctagggtcggcg
gacctgggtgtctgtctgcacacgtcctccagtggcctggacctgcccatgaaggtggtg
gacatgttcgggtgctgtttgcctgtgtgtgctgtgaacttcaagtgtttacatgagctg
gtgaaacatgaagaaaatggcctggtctttgaggactcagaggaactggcagctcagctg
cagatgcttttctcaaactttcctgatcctgcgggcaagctaaaccagttccggaagaac
ctgcgggagtcgcagcagctccgatgggatgagagctgggtgcagactgtgctccctttg
gttatggacacataa

DBGET integrated database retrieval system