KEGG   Homo sapiens (human): 5606Help
Entry
5606              CDS       T01001                                 

Gene name
MAP2K3, MAPKK3, MEK3, MKK3, PRKMK3, SAPKK-2, SAPKK2
Definition
mitogen-activated protein kinase kinase 3 (EC:2.7.12.2)
Orthology
K04432  
mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Rap1 signaling pathway
Toll-like receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Amyotrophic lateral sclerosis (ALS)
Toxoplasmosis
Influenza A
Epstein-Barr virus infection
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:hsa04664]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:hsa04912]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:hsa04750]
Human Diseases; Neurodegenerative diseases; Amyotrophic lateral sclerosis (ALS) [PATH:hsa05014]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:hsa05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q11.2
AA seq 318 aa AA seqDB search
MSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTI
MAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDK
FYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDF
GISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYE
SWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHK
TKKTDIAAFVKEILGEDS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagccacccgcacccaaccccacacccccccggaacctggactcccggaccttc
atcaccattggagacagaaactttgaggtggaggctgatgacttggtgaccatctcagaa
ctgggccgtggagcctatggggtggtagagaaggtgcggcacgcccagagcggcaccatc
atggccgtgaagcggatccgggccaccgtgaactcacaggagcagaagcggctgctcatg
gacctggacatcaacatgcgcacggtcgactgtttctacactgtcaccttctacggggca
ctattcagagagggagacgtgtggatctgcatggagctcatggacacatccttggacaag
ttctaccggaaggtgctggataaaaacatgacaattccagaggacatccttggggagatt
gctgtgtctatcgtgcgggccctggagcatctgcacagcaagctgtcggtgatccacaga
gatgtgaagccctccaatgtccttatcaacaaggagggccatgtgaagatgtgtgacttt
ggcatcagtggctacttggtggactctgtggccaagacgatggatgccggctgcaagccc
tacatggcccctgagaggatcaacccagagctgaaccagaagggctacaatgtcaagtcc
gacgtctggagcctgggcatcaccatgattgagatggccatcctgcggttcccttacgag
tcctgggggaccccgttccagcagctgaagcaggtggtggaggagccgtccccccagctc
ccagccgaccgtttctcccccgagtttgtggacttcactgctcagtgcctgaggaagaac
cccgcagagcgtatgagctacctggagctgatggagcaccccttcttcaccttgcacaaa
accaagaagacggacattgctgccttcgtgaaggagatcctgggagaagactcatag

DBGET integrated database retrieval system