KEGG   Homo sapiens (human): 5606Help
Entry
5606              CDS       T01001                                 

Gene name
MAP2K3, MAPKK3, MEK3, MKK3, PRKMK3, SAPKK-2, SAPKK2
Definition
mitogen-activated protein kinase kinase 3 (EC:2.7.12.2)
Orthology
K04432  
mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Rap1 signaling pathway
Toll-like receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Amyotrophic lateral sclerosis (ALS)
Toxoplasmosis
Influenza A
Epstein-Barr virus infection
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    5606 (MAP2K3)
   04010 MAPK signaling pathway
    5606 (MAP2K3)
   04668 TNF signaling pathway
    5606 (MAP2K3)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    5606 (MAP2K3)
   04664 Fc epsilon RI signaling pathway
    5606 (MAP2K3)
  Endocrine system
   04912 GnRH signaling pathway
    5606 (MAP2K3)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5606 (MAP2K3)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    5606 (MAP2K3)
  Infectious diseases
   05164 Influenza A
    5606 (MAP2K3)
   05169 Epstein-Barr virus infection
    5606 (MAP2K3)
   05145 Toxoplasmosis
    5606 (MAP2K3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     5606 (MAP2K3)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   5606 (MAP2K3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q11.2
AA seq 318 aa AA seqDB search
MSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTI
MAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDK
FYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDF
GISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYE
SWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHK
TKKTDIAAFVKEILGEDS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagccacccgcacccaaccccacacccccccggaacctggactcccggaccttc
atcaccattggagacagaaactttgaggtggaggctgatgacttggtgaccatctcagaa
ctgggccgtggagcctatggggtggtagagaaggtgcggcacgcccagagcggcaccatc
atggccgtgaagcggatccgggccaccgtgaactcacaggagcagaagcggctgctcatg
gacctggacatcaacatgcgcacggtcgactgtttctacactgtcaccttctacggggca
ctattcagagagggagacgtgtggatctgcatggagctcatggacacatccttggacaag
ttctaccggaaggtgctggataaaaacatgacaattccagaggacatccttggggagatt
gctgtgtctatcgtgcgggccctggagcatctgcacagcaagctgtcggtgatccacaga
gatgtgaagccctccaatgtccttatcaacaaggagggccatgtgaagatgtgtgacttt
ggcatcagtggctacttggtggactctgtggccaagacgatggatgccggctgcaagccc
tacatggcccctgagaggatcaacccagagctgaaccagaagggctacaatgtcaagtcc
gacgtctggagcctgggcatcaccatgattgagatggccatcctgcggttcccttacgag
tcctgggggaccccgttccagcagctgaagcaggtggtggaggagccgtccccccagctc
ccagccgaccgtttctcccccgagtttgtggacttcactgctcagtgcctgaggaagaac
cccgcagagcgtatgagctacctggagctgatggagcaccccttcttcaccttgcacaaa
accaagaagacggacattgctgccttcgtgaaggagatcctgggagaagactcatag

DBGET integrated database retrieval system