KEGG   Homo sapiens (human): 5607Help
Entry
5607              CDS       T01001                                 

Gene name
MAP2K5, HsT17454, MAPKK5, MEK5, PRKMK5
Definition
(RefSeq) mitogen-activated protein kinase kinase 5 (EC:2.7.12.2)
  KO
K04463  
mitogen-activated protein kinase kinase 5 [EC:2.7.12.2]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Gap junction
Neurotrophin signaling pathway
Oxytocin signaling pathway
Module
MAPK (ERK5) signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    5607 (MAP2K5)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    5607 (MAP2K5)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    5607 (MAP2K5)
  Nervous system
   04722 Neurotrophin signaling pathway
    5607 (MAP2K5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     5607 (MAP2K5)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   5607 (MAP2K5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q23
AA seq 448 aa AA seqDB search
MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAF
EYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGL
KVNTRAGPSQHSSPAVSDSLPSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNGGTV
YKAYHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISIC
TEFMDGGSLDVYRKMPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLC
DFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQ
KNQGSLMPLQLLQCIVDEDSPVLPVGEFSEPFVHFITQCMRKQPKERPAPEELMGHPFIV
QFNDGNAAVVSMWVCRALEERRSQQGPP
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggctagcccttggcccctttcctgccatggagaaccaggtgctggtaattcgc
atcaagatcccaaatagtggcgcggtggactggacagtgcactccgggccgcagttactc
ttcagggatgtgctggatgtgataggccaggttctgcctgaagcaacaactacagcattt
gaatatgaagatgaagatggtgatcgaattacagtgagaagtgatgaggaaatgaaggca
atgctgtcatattattattccacagtaatggaacagcaagtaaatggacagttaatagag
cctctgcagatatttccaagagcctgcaagcctcctggggaacggaacatacatggcctg
aaggtgaatactcgggccggaccctctcaacacagcagcccagcagtctcagattcactt
ccaagcaatagcttaaagaagtcttctgctgaactgaaaaaaatactagccaatggccag
atgaatgaacaagacatacgatatcgggacactcttggtcatggcaacggaggcacagtc
tacaaagcatatcatgtcccgagtgggaaaatattagctgtaaaggtcatactactagat
attacactggaacttcagaagcaaattatgtctgaattggaaattctttataagtgcgat
tcatcatatatcattggattttatggagcattttttgtagaaaacaggatttcaatatgt
acagaattcatggatgggggatctttggatgtatataggaaaatgccagaacatgtcctt
ggaagaattgcagtagcagttgttaaaggccttacttatttgtggagtttaaagatttta
catagagacgtgaagccctccaatatgctagtaaacacaagaggacaggttaagctgtgt
gattttggagttagcactcagctggtgaattctatagccaagacgtatgttggaacaaat
gcttatatggcgcctgaaaggatttcaggggagcagtatggaattcattctgatgtctgg
agcttaggaatctcttttatggagcttgctcttgggaggtttccatatcctcagattcag
aaaaaccagggatctttaatgcctctccagcttctgcagtgcattgttgatgaggattcg
cccgtccttccagttggagagttctcggagccatttgtacatttcatcactcagtgtatg
cgaaaacagccaaaagaaaggccagcacctgaagaattgatgggccacccgttcatcgtg
cagttcaatgatggaaatgccgccgtggtgtccatgtgggtgtgccgggcgctggaggag
aggcggagccagcaggggcccccgtga

DBGET integrated database retrieval system