KEGG   Homo sapiens (human): 5611Help
Entry
5611              CDS       T01001                                 

Gene name
DNAJC3, ERdj6, HP58, P58, P58IPK, PRKRI
Definition
DnaJ (Hsp40) homolog, subfamily C, member 3
Orthology
K09523  
DnaJ homolog subfamily C member 3
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    5611 (DNAJC3)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    5611 (DNAJC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q32.1
AA seq 504 aa AA seqDB search
MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQF
HAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGK
LDEAEDDFKKVLKSNPSENEEKEAQSQLIKSDEMQRLRSQALNAFGSGDYTAAIAFLDKI
LEVCVWDAELRELRAECFIKEGEPRKAISDLKAASKLKNDNTEAFYKISTLYYQLGDHEL
SLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIRDGRYTDATSKYESVMKTEPS
IAEYTVRSKERICHCFSKDEKPVEAIRVCSEVLQMEPDNVNALKDRAEAYLIEEMYDEAI
QDYETAQEHNENDQQIREGLEKAQRLLKQSQKRDYYKILGVKRNAKKQEIIKAYRKLALQ
WHPDNFQNEEEKKKAEKKFIDIAAAKEVLSDPEMRKKFDDGEDPLDAESQQGGGGNPFHR
SWNSWQGFNPFSSGGPFRFKFHFN
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggtggcccccggctccgtgaccagccggctgggctcggtattccccttcctgctagtc
ctggtggatctgcagtacgaaggtgctgaatgtggagtaaatgcagatgttgagaaacat
cttgaattgggcaagaaattacttgcagctggacagctagctgatgctttatctcagttt
catgctgccgtagatggtgaccctgataactatattgcttattatcggagggctactgtc
tttttagctatgggcaaatcaaaagctgcacttcctgatttaactaaagtgattcaattg
aagatggacttcactgcagcaagattacagagaggtcacttattactcaaacaaggaaaa
cttgatgaagcagaagatgattttaaaaaagtgctcaaatctaatccaagtgaaaatgaa
gaaaaggaagcacagtctcaacttataaaatctgatgaaatgcagcgtttgcgttcacaa
gcacttaacgcttttggaagtggagattatactgctgctatagccttccttgataagatt
ttagaggtttgtgtttgggatgcagaactacgggaacttcgagctgaatgttttataaaa
gaaggagaacctaggaaagctataagtgacttaaaagctgcgtcaaagttgaagaatgat
aatactgaagcgttttataaaataagcacactgtactaccaactaggagaccacgaactg
tccctcagtgaagttcgggaatgtcttaaacttgaccaggatcataaaaggtgttttgca
cactataaacaagtaaagaaacttaataagctgattgagtcagctgaagagctcatcaga
gatggcagatacacagatgctaccagcaaatatgaatctgtcatgaaaacagagccaagc
attgctgaatatacagttcgttcaaaggagaggatttgccactgcttttctaaggacgag
aagcctgttgaagctattagggtttgttctgaagttttacagatggaacctgacaatgtg
aatgccctgaaagatcgagcagaggcctatttgatagaggaaatgtatgatgaagctatt
caggattatgaaactgctcaggaacacaatgaaaatgatcagcagattcgagaaggtcta
gagaaagcacaaagattattgaaacagtcgcagaaacgagattattataaaatcttggga
gtaaaaagaaatgccaaaaagcaagaaattattaaagcataccgaaaattagcactgcag
tggcacccagataacttccagaatgaagaagaaaagaaaaaagctgagaaaaagttcatt
gatatagcagctgctaaagaagtcctctctgatccagaaatgagaaagaagtttgacgac
ggagaagatcctttggatgcagagagccagcaaggaggcggcggcaaccctttccacaga
agctggaactcatggcaagggttcaatcccttcagctcaggcggaccatttagatttaaa
ttccacttcaattaa

DBGET integrated database retrieval system