KEGG   Homo sapiens (human): 56171Help
Entry
56171             CDS       T01001                                 

Gene name
DNAH7
Definition
(RefSeq) dynein axonemal heavy chain 7
  KO
K10408  
dynein heavy chain, axonemal
Organism
hsa  Homo sapiens (human)
Pathway
Huntington's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    56171 (DNAH7)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     56171 (DNAH7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q32.3
AA seq 4024 aa AA seqDB search
MSSEQDKSASKEKSKKPVRFLPQLSMEKLASKEKFKAPARALPQLSMVSTKPHWQQAAPS
FHLSVKQDDESPEPFSVKNEQSHAEYMERFGKKGKLPHQVDDSYVGPSTSKSKGKSPHKE
RENFRSTLVNVIMQQDADLDSAVPDGSTIPKPTASAIEKDILRYYYYIHHGIDTDHVAPM
EDSWLEHVLDLVPQHLKVFTDSIVTLSDEMREDYLLSVRKSIVDFVLKDPREKGDDKKTD
ELPAHRAEMEILPKPWRKSFLAASSYIRDHLNAMNPTMLAVLDLWHTNFKKLRLVDIKEF
HNCQDALELSSFQNIIMRHMDSAKETLLKMWFPEVQNIYYQGNKKKQLPTGDSSAKLESF
FNCAAALMTLQLQDLTLVSMQDFTDLIAQPPDSVRAFEHPGFIMRLILDNDTIKFEPELS
DYIDIFLNVYDVMIKAVSFVPRVETKLYSKWESKSKPTTLKPIILNEIVDAHKEKIKEVI
MKESVAPTEHLRLYDKYDFLITRKAERDVDNFLAENHSYEKIIDEICKYQKLIEEIQYTS
IKTIRLGMFEMHCEELIRALVKRADIICGKLLAKMFRDHQEVNTRLCDEFERIAEKALST
PPNTAELMEMKAYIQKVEVTDMIELEQRLVDSKNCLAFLIEYVNFSPADMRLNNSVFQWY
GRMGEIFEEHRKIIKEKIEQYQEGLKLRCERFVEELESYAKQSEEFYSFGDLQDVQRYLK
KAQILNGKLDLAADKIEQFNAEEEAFGWLPSVYPQRKKIQDGLNPYLRLYETAVEFSSNY
RAWTEGPYHKVNPDQVEADIGNYWRGLYKLEKTFHDSPYALAMTKKVRSKVEDFKQHIPL
IQVICNPGLRPRHWEAMSAIVGYPLQPSDDSTVSSFLDMNLEPYIDRFEGISEAASKEYS
LEKAMEKMITEWDAVEFVIHSYRETGTFILASVDEIQMLLDDHIIKTQTMRGSPFIKPYE
KQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFTAVDKTWRDI
MRSVMQDKHVLTVVTIDRMLERLKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELL
EILSETKDPTRVQPHLKKCFEGIAKVEFTETLDITHMKSSEGEVVELIEIISTAKARGQV
EKWLVELERVMINSIHKVTGDATFAYTKYERINWVRDWPGQTVLCVSQIFWTKEVQTAIP
MGIKALEQYLKTCNRQIDDIVTLVRGKLSMQNRVTLGALVVLDVHARDVLSSLVKKNISD
DSDFEWLSQLRYYWQENHLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHL
HLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFD
EFNRIDLEVLSVVAQQILTIQRGINAGADILMFEGTELKLDPTCAVFITMNPGYAGRSEL
PDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSVKIVATYRLCSEQLSSQHHYDY
GMRAVKSVLTAAGNLKLKYPNENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVK
LPKPDYNDLLAAIKDNCASMNLQMTAFFSEKILQVYEMMIVRHGFMIVGEPFGGKTSAYR
VLAGALNDICEKGLMEENKVQITVLNPKSVTMGQLYGQFDSVSHEWSDGVLAVSFRAFAS
SVTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVAS
PATVSRCGMIYMEPHMLGWRPLMLSWVNLLPASVSVIQKEFIMGLFDRMVPVSVEFIRKH
TKELSPTSDTNLVRSLMNLIDCFMDDFADEVKLKERNDRETYSLLEGIFLFSLIWSVGAS
CTDDDRLKFNKILRELMESPISDRTRNTFKLQSGTEQTSSKALTVPFPEKGTIYDYQFVT
EGIGKWEPWIKKLKEAPPIPKDVMFNEIIVPTLDTIRYSALMELLTTHQKPSIFVGPTGT
GKSVYITNFLLNQLNKEIYKPLLINFSAQTTAAQTQNIVMSKLDKRRKGVFGPPLGKRMV
VFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSMIKLVDIQIMCAMGPPGGGRN
PVTPRYMRHFNIITINEFSDKSMYTIFSRILTWHLEICYKFPDEFLDLTTQIVNGTMTLY
KEAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETTETTEVIKRLWVHEVLRVYYDRL
LDNTDRSWLINYIQEILRNYMYEDFHELFQRLDFDNDGMVEADDLRSLMFCDFHDPKRED
TNYREIADVDNLRMIVEIHLEEYNNISKKPMNLVLFRFAIEHISRISRILKQPRSHALLV
GVGGSGRQSVTRLAAHMADYSVFQVEISKGYDTTEWHEDLKVILRKCAEGEMQGVFLFTD
TQIKEESFLEDVSNLLNAGEIPNLFALDEKQEICDKMRQLDRQRDKTKQTDGSPIALFNM
FIDHCRSQLHVVLAMSPIGDAFRNRLRKFPALVNCCTIDWFQSWPEDALQAVASRFLEEI
EMSEEIRDGCIDMCKSFHTSTIDLSKSFFVELQRYNYVTPTSYLELISTFKLLLEKKRSE
VMKMKKRYEVGLEKLDSASSQVATMQMELEALHPQLKVASKEVDEMMIMIEKESVEVAKT
EKIVKADETIANEQAMASKAIKDECDADLAGALPILESALAALDTLTAQDITVVKSMKSP
PAGVKLVMEAICILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDMRFLQSLHEYDKDNI
PPAYMNIIRKNYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAA
EGELKIAMDGLRKKQAALKEVQDKLARLQDTLELNKQKKADLENQVDLCSKKLERAEQLI
GGLGGEKTRWSHTALELGQLYINLTGDILISSGVVAYLGAFTSTYRQNQTKEWTTLCKGR
DIPCSDDCSLMGTLGEAVTIRTWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQSQANKW
IKNMEKANSLYVIKLSEPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGG
STCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVA
QERPDLEEEKQALILQGAENKRQLKEIEDKILEVLSSSEGNILEDETAIKILSSSKALAN
EISQKQEVAEETEKKIDTTRMGYRPIAIHSSILFFSLADLANIEPMYQYSLTWFINLFIL
SIENSEKSEILAKRLQILKDHFTYSLYVNVCRSLFEKDKLLFSFCLTINLLLHERAINKA
EWRFLLTGGIGLDNPYANLCTWLPQKSWDEICRLDDLPAFKTIRREFMRLKDGWKKVYDS
LEPHHEVFPEEWEDKANEFQRMLIIRCLRPDKVIPMLQEFIINRLGRAFIEPPPFDLAKA
FGDSNCCAPLIFVLSPGADPMAALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVK
EGTWVVLQNCHLATSWMPTLEKVCEELSPESTHPDFRMWLTSYPSPNFPVSVLQNGVKMT
NEAPKGLRANIIRSYLMDPISDPEFFGSCKKPEEFKKLLYGLCFFHALVQERRKFGPLGW
NIPYEFNETDLRISVQQLHMFLNQYEELPYEALRYMTGECNYGGRVTDDWDRRTLRSILN
KFFNPELVENSDYKFDSSGIYFVPPSGDHKSYIEYTKTLPLTPAPEIFGMNANADITKDQ
SETQLLFDNILLTQSRSAGAGAKSSDEVVNEVASDILGKLPNNFDIEAAMRRYPTTYTQS
MNTVLVQEMGRFNKLLKTIRDSCVNIQKAIKGLAVMSTDLEEVVSSILNVKIPEMWMGKS
YPSLKPLGSYVNDFLARLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNYARKYTIPI
DLLGFDYEVMEDKEYKHPPEDGVFIHGLFLDGASWNRKIKKLAESHPKILYDTVPVMWLK
PCKRADIPKRPSYVAPLYKTSERRGVLSTTGHSTNFVIAMTLPSDQPKEHWIGRGVALLC
QLNS
NT seq 12075 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtgagcaggataaatcggccagcaaagaaaaatccaagaaaccagtaagattt
ctaccacagctgtctatggagaaattagccagcaaagaaaagttcaaggcaccagcaaga
gctttaccacagctgtctatggtgagtacaaagccccactggcagcaggcagctccatca
ttccatttgagtgtaaagcaggatgatgagagtccagaaccatttagtgttaaaaatgaa
cagtcccatgctgaatacatggaacgttttggaaaaaagggcaaattaccccaccaagtt
gatgatagttatgttggaccatctacttccaaatcaaagggcaaatctccacataaagaa
cgagaaaactttagaagtactcttgttaatgtcattatgcaacaagatgctgacttagac
tcagctgtccctgatggaagcacaattccaaaaccgaccgcttctgctatagagaaagac
atcttgagatattactattatattcaccatggaattgatacagaccatgtagccccaatg
gaagattcttggctagaacacgtactggatttagttccacaacatctgaaagtcttcact
gacagcatagttacattatctgatgaaatgagagaggattatcttcttagtgtaaggaaa
tccatagttgattttgttttaaaagatcctcgagagaaaggagatgataagaagacagat
gaacttccagcccatcgtgctgaaatggaaattctgccaaaaccttggaggaaatctttt
ttagctgcaagcagttatattagggatcacttgaatgcaatgaaccccacaatgctggct
gtactagatttgtggcacactaattttaaaaaattacgtttagttgatatcaaagaattt
cataattgccaggatgcattagagctgtcaagttttcagaacattatcatgagacacatg
gactctgccaaagagactctacttaaaatgtggtttccagaagtgcagaatatttattac
caaggtaataaaaaaaagcaattgccaactggtgacagcagtgccaaattggaatctttt
ttcaactgtgctgctgcacttatgactttacagctgcaggacctcactttagtctccatg
caagatttcacggacttaattgcacaacccccagattctgttagagcttttgaacatcca
ggtttcatcatgaggctgattcttgataatgacaccattaagtttgaacctgagttgagt
gactatatagatatctttctaaatgtttatgacgtcatgattaaagctgtcagttttgtg
ccaagagttgagacaaaattgtattccaagtgggaaagtaagtctaaaccaacaaccttg
aagcccataattctgaatgaaattgtagatgctcacaaagaaaagatcaaggaagttatt
atgaaagagagtgtggcacctactgagcacctcagactctatgacaagtatgacttttta
attaccagaaaagctgagcgagatgttgataacttcctcgcagaaaatcatagttatgaa
aaaataatagatgaaatttgcaaataccagaaactaatagaggaaatacagtacacatcc
ataaagactattcgtttaggaatgtttgaaatgcactgtgaggaattaatcagagctttg
gtgaagcgagcagatattatttgtgggaaacttctagctaaaatgttcagagatcatcag
gaagtaaatacaagattatgcgatgaatttgagaggatagctgaaaaagctcttagcact
cctccaaatacagcagaactaatggaaatgaaggcttacattcagaaagtggaggtaact
gatatgattgaactagaacagagattagtggattccaaaaactgcctcgccttcctcatc
gagtatgtcaacttttctccagcagacatgaggctaaataatagtgttttccagtggtat
ggaaggatgggagaaatttttgaagaacacaggaaaatcattaaagagaaaatagaacaa
tatcaagaaggtctgaagttacggtgtgaacggtttgtggaggaattggagagttatgct
aagcaatcagaagaattttattcatttggagatcttcaggatgttcagcggtacctaaaa
aaggctcaaatactgaatggaaagttggatttagctgcagataagattgagcagtttaat
gctgaagaggaagcatttggttggctaccatctgtatatcctcaacgtaaaaaaatccaa
gatggcttgaacccttatcttcgtctttatgaaactgctgtcgaatttagcagcaactat
agagcatggacagaagggccatatcataaagtgaatccagaccaagtagaagcagatatt
ggaaattactggagaggattatataaactggagaaaacctttcatgattctccatatgca
ttggcaatgacaaaaaaagtaagatcaaaggtggaagatttcaagcagcacattcctctc
attcaagtgatctgtaatcctggtttgcgccccaggcactgggaggccatgtctgccatt
gttggttaccctttgcagccatcagatgactccacagtctcctcttttttagacatgaat
ctggaaccatatatagaccgatttgaaggtattagtgaagcagctagcaaagaatattct
cttgaaaaggcgatggagaagatgattactgagtgggatgcagtggaatttgtcatccat
tcttatagagaaactgggacatttattttggcatcagttgatgaaattcagatgttgttg
gatgaccatattattaaaacacaaactatgcgaggatctcctttcattaagccttatgaa
aaacaaatgagagaatgggagggcaagctcctactgcttcaggagattctggatgaatgg
ctcaaagtccaagccacgtggctgtatctggagcccattttcagctctccagacattatg
tctcaaatgcctgaggaaggcagacgatttacagctgtggataagacatggagagatata
atgagaagtgtcatgcaggataaacatgttctgacagttgtaaccattgacagaatgctg
gaaaggctgaaaaaatctaatgaacttttggagctcattcttaaaggacttaatgaatat
ttggaaaagaaacgcctctttttccccagattcttttttttgtccaatgatgaacttctt
gagatactatctgagactaaagatcccactagggtgcaacctcacttgaagaaatgtttt
gaaggaatcgcaaaggtagaatttacggaaactttagacattactcacatgaagagcagc
gaaggagaggttgtagaactcatagagattatttcaacagccaaagccagaggtcaagtg
gagaagtggttggttgaattagagagagttatgattaactccatccacaaggtaactgga
gatgcaacttttgcctatacaaaatatgaacgaattaactgggtaagggattggcctgga
cagactgttctctgtgtatcccaaatcttttggacaaaagaagtacaaacagctattcca
atggggataaaggctcttgagcaatacttgaaaacatgtaacagacaaattgatgatatt
gtcactttggtgcgtggcaaattgtccatgcagaatcgcgtaactctgggagcacttgtg
gtactggatgtccatgctagagatgtcctctcatcacttgtaaaaaaaaatattagcgat
gactctgactttgaatggttaagtcagcttaggtactactggcaagaaaatcatttagaa
acaaaaatgatcaatgctggtttgcgatatggatatgaatatctgggtaattcccctagg
ctggttattacaccactcacggatagatgttacagaaccttatttggagcccttcatttg
caccttggaggagcacctgagggtccagctggcactgggaagactgaaactaccaaggat
ttggcaaaagctgtagccaaacaatgtgttgttttcaactgctctgatgggttggattat
ttggctttgggaaaattctttaagggactgttatcttgtggagcctgggcttgctttgat
gagtttaacagaattgatttggaagtactctctgtggttgctcaacaaatccttactatc
caaagaggtattaatgcaggtgctgatatactgatgtttgaaggaactgaactaaaactt
gaccccacatgtgctgtctttataacaatgaaccctgggtatgctgggcgatcagaactg
ccagataacctgaaggctctctttcggacagtagcaatgatggtacctgactatgccatg
attgctgaaatagtcctatactcctgtgggtttgtcactgctcgaccactgtctgtaaaa
attgtggctacgtatcgcttgtgttcagagcagctgtcatctcaacatcactacgactat
ggaatgagagccgtgaagtcagttcttactgctgctgggaatctgaagctgaaatatcca
aatgaaaatgaagaaattttgctgcttagatctatcattgatgtaaatctgccaaaattt
ttatcccatgatttaccactctttgagggaattacttcggatttgtttcctggggtaaaa
ttaccaaaaccagattacaatgatttgctggcagctatcaaagacaattgtgcctccatg
aatttgcaaatgactgcattcttttccgagaagattcttcaagtatatgaaatgatgatt
gtgcgtcatggttttatgattgttggagaaccatttggaggaaaaactagtgcatatcgt
gtcttagctggagcactaaatgatatatgtgaaaaggggctaatggaagaaaacaaagtt
caaataactgttttaaatcctaagtctgtcaccatgggccaactgtacggacagtttgat
tcagtgtcccatgaatggtctgatggggtccttgctgtcagttttagagcatttgcctct
tcagtgactccagataggaaatggttaatttttgatggcccagtagatgcagtgtggatt
gagaatatgaacactgtgctggatgacaacaagaagctatgtctgatgagtggggagatt
attcagatgtcaccacaaatgaatctaatttttgagccaatggatttagaagttgcttcc
cctgccactgtttccagatgtggcatgatttacatggagcctcacatgttaggctggaga
ccactgatgttgtcctgggtgaatctgttacctgcgtcagtcagtgttattcaaaaggaa
ttcataatgggcttatttgacagaatggtccctgtttcggttgaatttattagaaagcat
acaaaggaattatctcctacttccgatacaaacttggtccggtccttaatgaatctaata
gactgttttatggatgattttgctgatgaagtcaaactaaaggagagaaatgatcgagaa
acttactctttgcttgagggcatttttctgttttcattgatctggtccgttggtgcttct
tgtacagatgatgatcgattgaaatttaataagattcttcgagaactaatggaaagtcca
atttcagatcgaactcgaaatacgtttaaattacagagtggtactgagcaaacatcctca
aaggcactaactgtcccatttcctgaaaaaggaacaatttatgattatcaatttgtcact
gagggaataggaaaatgggaaccatggataaagaaattgaaagaagctcctccaattcct
aaagatgtaatgtttaatgaaatcattgtgccaactctggacacaattcgatactctgca
ttaatggaattgctgaccacccatcaaaagccttcaatatttgtaggaccaacaggaact
gggaaaagtgtttacattacgaattttcttttaaatcaactaaataaggaaatctacaaa
cctctgctaattaacttctcagcacaaactacagcagctcaaactcagaatattgtcatg
tcaaaattggacaagagaagaaagggagtttttggtcctcctttgggcaagagaatggtt
gtctttgtagatgatgtcaatatgcctgctcgggaggtatatggggctcaacctcccatt
gagttacttagacagtggttagaccactggaactggtatgatctaaaagattgttccatg
attaaactagtggacattcagatcatgtgtgctatgggacctccaggtggtggtcgaaat
ccagtaactcctcgatacatgcgacatttcaatattataacaatcaatgagtttagtgat
aaatccatgtatacaatcttctctagaatcttaacttggcatttagaaatctgttataaa
tttccagatgaatttctagatttgaccacacaaatcgtaaatggcacaatgactctgtat
aaagaagcaatgaagaatctcttgcctactccagctaaatctcactacttgttcaacctc
cgtgatttctcccgtgtcattcaaggtgtttgtttgtcaagaccagaaacaacagaaacc
acagaagtgattaaacgtctttgggttcatgaggtccttcgagtgtattatgaccgcctt
ctggacaatacagacagaagctggctcatcaactacattcaagaaattttgagaaactac
atgtatgaagattttcatgagctttttcagcgtttggattttgataatgatggcatggtg
gaagcagatgacttacgcagcttaatgttttgtgatttccatgatcccaagagggaggat
accaactacagagaaatcgcagatgtggataatcttcgaatgatagtagaaattcaccta
gaagaatacaacaatataagcaaaaaacccatgaaccttgtcttgtttcgatttgccata
gagcacatcagcagaatttccaggatcctgaagcagcctcgcagccatgctctcctagta
ggggttggagggagtggaaggcagtctgtcaccagattagctgcccacatggctgattat
tcagttttccaagttgaaatctctaaggggtatgatactactgaatggcatgaagattta
aaagtgatcttaaggaaatgtgcggaaggtgagatgcagggtgtcttcctgtttacagat
actcaaattaaagaagagtcttttctggaagatgtcagtaatctgctaaatgctggggag
attccaaatctctttgcattagatgagaagcaagagatatgtgataagatgcgtcagtta
gatcgccagcgggataaaaccaagcaaacagatggcagccccatagcccttttcaacatg
tttattgatcattgccgcagccaactgcatgtggtccttgccatgagtcccattggagat
gcatttcggaatcgtcttagaaagttccctgctcttgttaactgctgtaccattgactgg
tttcagtcatggcctgaagatgcactccaggcagttgcctcacgattcttggaagaaatt
gaaatgtcagaggaaatacgagatggctgtatcgacatgtgtaaaagcttccacacttct
actatagatttatccaaatctttctttgttgaacttcaaagatacaattatgtgactcct
acctcttacctcgaattaatctccaccttcaaactgttgttagaaaagaaaagaagtgaa
gtaatgaaaatgaaaaagagatatgaagtgggtttggagaaactggattctgcttcatct
caagtagccacaatgcagatggagttggaggcactacatcctcaattaaaagttgctagc
aaagaggttgatgaaatgatgataatgattgagaaagagtctgtagaagttgccaaaact
gaaaaaatagtgaaagctgatgaaacaatagcgaatgaacaagctatggcttccaaagcc
atcaaagatgagtgcgatgctgacctggcaggtgccttgccaatattagagtcagcactg
gccgcccttgatactcttactgcacaggatattacagtggtaaaatccatgaagagtcct
cctgctggtgtcaagcttgttatggaagctatatgcatcttgaaaggaatcaaagctgac
aaaatccctgacccaacaggttcagggaaaaaaattgaggatttctggggcccagctaag
agacttcttggtgacatgaggtttctgcagtcacttcatgaatatgacaaggacaatatt
cctccagcttatatgaatatcataagaaaaaattatattccaaatccagattttgtacca
gaaaaaatcagaaatgcttctacagcggccgaaggtctgtgcaaatgggtcatagcaatg
gattcatatgataaagtggcaaaaatagtagctcccaaaaagataaaactggctgcagct
gaaggggagcttaaaattgccatggatggtcttagaaagaagcaggcagcccttaaggaa
gttcaggacaagctggccaggcttcaagacacacttgaattaaataaacaaaagaaggct
gacctggaaaaccaggttgacctttgcagcaaaaaactagaacgagctgaacagttgatt
ggaggccttggaggtgagaaaactcgatggagccacacagctctggagctaggtcagctg
tacatcaacttgactggggatatcctcatttcctccggagtggttgcttacctcggagcc
ttcacatccacctatagacagaatcaaactaaagagtggacaactttgtgcaaaggaaga
gatatcccctgctcagatgattgctctcttatgggtaccctgggagaagctgtgacaatt
cgaacttggaatattgctggattaccttctgactcattttccattgataatgggataatc
ataatgaatgcaagaaggtggcctctgatgatagatcctcaaagtcaggctaataaatgg
atcaagaacatggaaaaagccaatagtctttatgtgattaaacttagtgaacctgactat
gtcaggactctggaaaattgcatccagtttggtactcctgtgttgctagaaaatgttggc
gaagaactagatcctattttggaacctcttctactaaaacaaacctttaagcagggtggg
agtacatgtatccggcttggggactccacaattgaatatgcacctgacttccgcttctat
attactaccaagttaagaaatcctcattatcttcctgaaacatcagtaaaggtaacatta
ttaaacttcatgataacccctgagggaatgcaagatcagcttctgggaattgtggtggca
caagaaaggccagaccttgaagaagaaaagcaagccttgatattacaaggagctgaaaat
aaaaggcagttaaaagaaatagaagacaagattttagaagttctttcatcttcggaaggc
aatatattagaagatgaaactgctattaagatattatcttcctccaaggccttggctaat
gagatttctcagaagcaggaagtagccgaagagacagagaaaaagattgacaccacccgc
atgggctatcgtcctattgccatccattcttccatcctatttttttctcttgctgattta
gccaacattgagcccatgtaccagtattcactgacctggtttattaaccttttcatcctg
tctattgaaaattcagagaaatcagaaattttggcaaaaaggcttcagattctcaaggat
cactttacttattcactgtatgttaatgtctgccggtcactctttgaaaaggataagctg
ctcttttccttttgtctaaccataaatctactgctgcatgagcgggcgattaataaagct
gagtggagatttctgctaactggtggcattggactggataatccttatgccaacctttgt
acatggcttcctcagaaatcctgggatgaaatatgtcgattagatgatttgcctgccttc
aaaaccattcgtagagagtttatgcgcttaaaggatggatggaagaaagtatatgatagt
ttggaaccacaccatgaggttttccctgaagaatgggaagataaagcaaatgagtttcaa
aggatgcttattattcgttgcttgaggccagacaaggttattccaatgttgcaggaattt
ataatcaacagattgggacgtgcattcattgaaccacccccctttgatttagccaaggca
tttggagacagtaactgctgtgcaccactgattttcgtgctctctcctggagcagatccc
atggctgcccttctaaaatttgctgatgaccagggatatgggggatcaaaacttagctct
ttatctcttggtcaaggccaagggcccattgctatgaagatgttagaaaaagctgtcaag
gaaggaacatgggttgttcttcagaattgtcaccttgccacctcttggatgccaaccctt
gagaaagtctgtgaggagttaagcccagagtcaacacatccagatttccgaatgtggcta
acgagttacccatctccaaatttccctgtgtcagtactgcagaatggagtgaaaatgacc
aatgaagcaccaaaaggtttacgggctaatatcattcgatcatacctcatggacccgatc
tctgatccggagttctttggcagctgcaaaaagcctgaggaattcaagaaattgctttat
ggcctgtgtttctttcatgctttggtacaagaaagacggaaatttggacccctagggtgg
aatattccttatgagttcaatgagacagatctgagaatcagcgtacagcagctccacatg
ttcctgaaccagtatgaggaactgccgtatgaggctctgcggtacatgactggcgaatgc
aattacggaggcagagtgaccgatgactgggaccggcgcacgctgcgcagcattctaaac
aaattcttcaatcccgaattagttgaaaattcagactataagttcgactcaagtggcatc
tattttgttcctccttctggtgatcacaaaagctacatcgaatacacaaagactctgcca
ctgaccccagcaccagaaatctttgggatgaatgccaatgcagatatcactaaggatcag
tcagaaactcagctgctatttgataacattcttcttacacagtctcgttcagcaggtgct
ggtgcaaaatcatcagatgaagtagtgaatgaggtcgctagtgacatcttgggcaaactt
ccaaacaacttcgacatcgaggctgccatgaggaggtacccaacaacttatactcagagc
atgaacactgtacttgtccaagagatgggacggttcaataagttactgaagaccataaga
gattcgtgcgtaaatattcaaaaagcaatcaaggggcttgcagtcatgtctacagatctt
gaagaagtggttagcagcattttgaatgtcaaaattccagaaatgtggatgggtaaatcc
tacccaagccttaaaccacttggcagctatgtgaatgacttccttgcaagactaaaattc
ttgcagcaatggtatgaggttggtcctcctccagtcttctggctttctggcttcttcttc
acacaagccttcctgaccggtgcccagcagaactacgccaggaaatacacaattcctatt
gatcttcttgggtttgactatgaagtgatggaagacaaagaatacaagcatcctcctgag
gatggtgttttcattcacggattatttctggatggagcttcctggaatagaaagatcaag
aaacttgcagaatcgcatcccaaaattctttatgatacagtgcctgtgatgtggctaaag
ccctgtaagagggcagatataccaaaacggccaagttatgttgctccattgtataagaca
agtgagcggagaggagtattatccaccactggccattccacgaattttgtgattgccatg
actcttccctctgaccaacccaaggaacactggattggacgaggtgtagcactgttatgt
caacttaattcataa

DBGET integrated database retrieval system