KEGG   Homo sapiens (human): 56172Help
Entry
56172             CDS       T01001                                 

Gene name
ANKH, ANK, CCAL2, CMDJ, CPPDD, HANK, MANK
Definition
(RefSeq) ANKH inorganic pyrophosphate transport regulator
Organism
hsa  Homo sapiens (human)
Disease
H00491  
Craniometaphyseal dysplasia
H01236  
Familial articular chondrocalcinosis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5p15.1
AA seq 492 aa AA seqDB search
MVKFPALTHYWPLIRFLVPLGITNIAIDFGEQALNRGIAAVKEDAVEMLASYGLAYSLMK
FFTGPMSDFKNVGLVFVNSKRDRTKAVLCMVVAGAIAAVFHTLIAYSDLGYYIINKLHHV
DESVGSKTRRAFLYLAAFPFMDAMAWTHAGILLKHKYSFLVGCASISDVIAQVVFVAILL
HSHLECREPLLIPILSLYMGALVRCTTLCLGYYKNIHDIIPDRSGPELGGDATIRKMLSF
WWPLALILATQRISRPIVNLFVSRDLGGSSAATEAVAILTATYPVGHMPYGWLTEIRAVY
PAFDKNNPSNKLVSTSNTVTAAHIKKFTFVCMALSLTLCFVMFWTPNVSEKILIDIIGVD
FAFAELCVVPLRIFSFFPVPVTVRAHLTGWLMTLKKTFVLAPSSVLRIIVLIASLVVLPY
LGVHGATLGVGSLLAGFVGESTMVAIAACYVYRKQKKKMENESATEGEDSAMTDMPPTEE
VTDIVEMREENE
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaattcccggcgctcacgcactactggcccctgatccggttcttggtgcccctg
ggcatcaccaacatagccatcgacttcggggagcaggccttgaaccggggcattgctgct
gtcaaggaggatgcagtcgagatgctggccagctacgggctggcgtactccctcatgaag
ttcttcacgggtcccatgagtgacttcaaaaatgtgggcctggtgtttgtgaacagcaag
agagacaggaccaaagccgtcctgtgtatggtggtggcaggggccatcgctgccgtcttt
cacacactgatagcttatagtgatttaggatactacattatcaataaactgcaccatgtg
gacgagtcggtggggagcaagacgagaagggccttcctgtacctcgccgcctttcctttc
atggacgcaatggcatggacccatgctggcattctcttaaaacacaaatacagtttcctg
gtgggatgtgcctcaatctcagatgtcatagctcaggttgtttttgtagccattttgctt
cacagtcacctggaatgccgggagcccctgctcatcccgatcctctccttgtacatgggc
gcacttgtgcgctgcaccaccctgtgcctgggctactacaagaacattcacgacatcatc
cctgacagaagtggcccggagctggggggagatgcaacaataagaaagatgctgagcttc
tggtggcctttggctctaattctggccacacagagaatcagtcggcctattgtcaacctc
tttgtttcccgggaccttggtggcagttctgcagccacagaggcagtggcgattttgaca
gccacataccctgtgggtcacatgccatacggctggttgacggaaatccgtgctgtgtat
cctgctttcgacaagaataaccccagcaacaaactggtgagcacgagcaacacagtcacg
gcagcccacatcaagaagttcaccttcgtctgcatggctctgtcactcacgctctgtttc
gtgatgttttggacacccaacgtgtctgagaaaatcttgatagacatcatcggagtggac
tttgcctttgcagaactctgtgttgttcctttgcggatcttctccttcttcccagttcca
gtcacagtgagggcgcatctcaccgggtggctgatgacactgaagaaaaccttcgtcctt
gcccccagctctgtgctgcggatcatcgtcctcatcgccagcctcgtggtcctaccctac
ctgggggtgcacggtgcgaccctgggcgtgggctccctcctggcgggctttgtgggagaa
tccaccatggtcgccatcgctgcgtgctatgtctaccggaagcagaaaaagaagatggag
aatgagtcggccacggagggggaagactctgccatgacagacatgcctccgacagaggag
gtgacagacatcgtggaaatgagagaggagaatgaataa

DBGET integrated database retrieval system