KEGG   Homo sapiens (human): 5618Help
Entry
5618              CDS       T01001                                 

Gene name
PRLR, HPRL, MFAB, hPRLrI
Definition
prolactin receptor
Orthology
K05081  
prolactin receptor
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Prolactin signaling pathway
Disease
H01388  
Hyperprolactinemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    5618 (PRLR)
   04151 PI3K-Akt signaling pathway
    5618 (PRLR)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5618 (PRLR)
   04060 Cytokine-cytokine receptor interaction
    5618 (PRLR)
 Organismal Systems
  Endocrine system
   04917 Prolactin signaling pathway
    5618 (PRLR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5p13.2
AA seq 622 aa AA seqDB search
MKENVASATVFTLLLFLNTCLLNGQLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNY
SLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVD
VTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEW
EIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVWIS
VAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQD
FPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLL
SEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQ
PSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREVE
SFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGKPKKPGTP
ENNKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSS
KCRLQLGGLDYLDPACFTHSFH
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaaatgtggcatctgcaaccgttttcactctgctactttttctcaacacctgc
cttctgaatggacagttacctcctggaaaacctgagatctttaaatgtcgttctcccaat
aaggaaacattcacctgctggtggaggcctgggacagatggaggacttcctaccaattat
tcactgacttaccacagggaaggagagacactcatgcatgaatgtccagactacataacc
ggtggccccaactcctgccactttggcaagcagtacacctccatgtggaggacatacatc
atgatggtcaatgccactaaccagatgggaagcagtttctcggatgaactttatgtggac
gtgacttacatagttcagccagaccctcctttggagctggctgtggaagtaaaacagcca
gaagacagaaaaccctacctgtggattaaatggtctccacctaccctgattgacttaaaa
actggttggttcacgctcctgtatgaaattcgattaaaacccgagaaagcagctgagtgg
gagatccattttgctgggcagcaaacagagtttaagattctcagcctacatccaggacag
aaataccttgtccaggttcgctgcaaaccagaccatggatactggagtgcatggagtcca
gcgaccttcattcagatacctagtgacttcaccatgaatgatacaaccgtgtggatctct
gtggctgtcctttctgctgtcatctgtttgattattgtctgggcagtggctttgaagggc
tatagcatggtgacctgcatctttccgccagttcctgggccaaaaataaaaggatttgat
gctcatctgttggagaagggcaagtctgaagaactactgagtgccttgggatgccaagac
tttcctcccacttctgactatgaggacttgctggtggagtatttagaagtagatgatagt
gaggaccagcatctaatgtcagtccattcaaaagaacacccaagtcaaggtatgaaaccc
acatacctggatcctgacactgactcaggccgggggagctgtgacagcccttcccttttg
tctgaaaagtgtgaggaaccccaggccaatccctccacattctatgatcctgaggtcatt
gagaagccagagaatcctgaaacaacccacacctgggacccccagtgcataagcatggaa
ggcaaaatcccctattttcatgctggtggatccaaatgttcaacatggcccttaccacag
cccagccagcacaaccccagatcctcttaccacaatattactgatgtgtgtgagctggct
gtgggccctgcaggtgcaccggccactctgttgaatgaagcaggtaaagatgctttaaaa
tcctctcaaaccattaagtctagagaagagggaaaggcaacccagcagagggaggtagaa
agcttccattctgagactgaccaggatacgccctggctgctgccccaggagaaaaccccc
tttggctccgctaaacccttggattatgtggagattcacaaggtcaacaaagatggtgca
ttatcattgctaccaaaacagagagagaacagcggcaagcccaagaagcccgggactcct
gagaacaataaggagtatgccaaggtgtccggggtcatggataacaacatcctggtgttg
gtgccagatccacatgctaaaaacgtggcttgctttgaagaatcagccaaagaggcccca
ccatcacttgaacagaatcaagctgagaaagccctggccaacttcactgcaacatcaagc
aagtgcaggctccagctgggtggtttggattacctggatcccgcatgttttacacactcc
tttcactga

DBGET integrated database retrieval system