KEGG   Homo sapiens (human): 5621Help
Entry
5621              CDS       T01001                                 

Gene name
PRNP, ASCR, AltPrP, CD230, CJD, GSS, KURU, PRIP, PrP, PrP27-30, PrP33-35C, PrPc, p27-30
Definition
prion protein
Orthology
K05634  
prion protein
Organism
hsa  Homo sapiens (human)
Pathway
Prion diseases
Disease
H00061  
Prion diseases
H01243  
Huntington's disease-like syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Neurodegenerative diseases
   05020 Prion diseases
    5621 (PRNP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5621 (PRNP)
Cellular antigens [BR:hsa04090]
 Proteins
  5621 (PRNP)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Others
  5621 (PRNP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20p13
AA seq 253 aa AA seqDB search
MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQP
HGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGA
VVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCV
NITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGSSMVLFSSPPV
ILLISFLIFLIVG
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaccttggctgctggatgctggttctctttgtggccacatggagtgacctgggc
ctctgcaagaagcgcccgaagcctggaggatggaacactgggggcagccgatacccgggg
cagggcagccctggaggcaaccgctacccacctcagggcggtggtggctgggggcagcct
catggtggtggctgggggcagcctcatggtggtggctgggggcagccccatggtggtggc
tggggacagcctcatggtggtggctggggtcaaggaggtggcacccacagtcagtggaac
aagccgagtaagccaaaaaccaacatgaagcacatggctggtgctgcagcagctggggca
gtggtggggggccttggcggctacatgctgggaagtgccatgagcaggcccatcatacat
ttcggcagtgactatgaggaccgttactatcgtgaaaacatgcaccgttaccccaaccaa
gtgtactacaggcccatggatgagtacagcaaccagaacaactttgtgcacgactgcgtc
aatatcacaatcaagcagcacacggtcaccacaaccaccaagggggagaacttcaccgag
accgacgttaagatgatggagcgcgtggttgagcagatgtgtatcacccagtacgagagg
gaatctcaggcctattaccagagaggatcgagcatggtcctcttctcctctccacctgtg
atcctcctgatctctttcctcatcttcctgatagtgggatga

DBGET integrated database retrieval system