KEGG   Homo sapiens (human): 5621Help
Entry
5621              CDS       T01001                                 

Gene name
PRNP, ASCR, AltPrP, CD230, CJD, GSS, KURU, PRIP, PrP, PrP27-30, PrP33-35C, PrPc, p27-30
Definition
(RefSeq) prion protein
  KO
K05634  prion protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04216  Ferroptosis
hsa05020  Prion diseases
Disease
H00061  Prion diseases
H01243  Huntington's disease-like syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04216 Ferroptosis
    5621 (PRNP)
 Human Diseases
  Neurodegenerative diseases
   05020 Prion diseases
    5621 (PRNP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5621 (PRNP)
CD molecules [BR:hsa04090]
 Proteins
  5621 (PRNP)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Others
   5621 (PRNP)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Others
  5621 (PRNP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Prion Prion_bPrPp
Motif
Other DBs
NCBI-GeneID: 5621
NCBI-ProteinID: NP_000302
OMIM: 176640
HGNC: 9449
Ensembl: ENSG00000171867
Vega: OTTHUMG00000031786
Pharos: P04156(Tchem)
UniProt: P04156 Q53YK7
Structure
PDB: 

Jmol
Position
20p13
AA seq 253 aa AA seqDB search
MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQP
HGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGA
VVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCV
NITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGSSMVLFSSPPV
ILLISFLIFLIVG
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaccttggctgctggatgctggttctctttgtggccacatggagtgacctgggc
ctctgcaagaagcgcccgaagcctggaggatggaacactgggggcagccgatacccgggg
cagggcagccctggaggcaaccgctacccacctcagggcggtggtggctgggggcagcct
catggtggtggctgggggcagcctcatggtggtggctgggggcagccccatggtggtggc
tggggacagcctcatggtggtggctggggtcaaggaggtggcacccacagtcagtggaac
aagccgagtaagccaaaaaccaacatgaagcacatggctggtgctgcagcagctggggca
gtggtggggggccttggcggctacatgctgggaagtgccatgagcaggcccatcatacat
ttcggcagtgactatgaggaccgttactatcgtgaaaacatgcaccgttaccccaaccaa
gtgtactacaggcccatggatgagtacagcaaccagaacaactttgtgcacgactgcgtc
aatatcacaatcaagcagcacacggtcaccacaaccaccaagggggagaacttcaccgag
accgacgttaagatgatggagcgcgtggttgagcagatgtgtatcacccagtacgagagg
gaatctcaggcctattaccagagaggatcgagcatggtcctcttctcctctccacctgtg
atcctcctgatctctttcctcatcttcctgatagtgggatga

DBGET integrated database retrieval system