KEGG   Homo sapiens (human): 5624Help
Entry
5624              CDS       T01001                                 

Gene name
PROC, APC, PC, PROC1, THPH3, THPH4
Definition
protein C (inactivator of coagulation factors Va and VIIIa) (EC:3.4.21.69)
Orthology
K01344  
protein C (activated) [EC:3.4.21.69]
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Disease
H00223  
Inherited thrombophilia
Drug target
Other: 
Class
Organismal Systems; Immune system; Complement and coagulation cascades [PATH:hsa04610]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q13-q14
AA seq 461 aa AA seqDB search
MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERECI
EEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSC
DCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVK
FPCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLDSKKKLACGA
VLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIKEVFVHPNYSKSTTDNDI
ALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVL
NFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLV
SWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAPQKSWAP
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagctcacaagcctcctgctgttcgtggccacctggggaatttccggcacacca
gctcctcttgactcagtgttctccagcagcgagcgtgcccaccaggtgctgcggatccgc
aaacgtgccaactccttcctggaggagctccgtcacagcagcctggagcgggagtgcata
gaggagatctgtgacttcgaggaggccaaggaaattttccaaaatgtggatgacacactg
gccttctggtccaagcacgtcgacggtgaccagtgcttggtcttgcccttggagcacccg
tgcgccagcctgtgctgcgggcacggcacgtgcatcgacggcatcggcagcttcagctgc
gactgccgcagcggctgggagggccgcttctgccagcgcgaggtgagcttcctcaattgc
tcgctggacaacggcggctgcacgcattactgcctagaggaggtgggctggcggcgctgt
agctgtgcgcctggctacaagctgggggacgacctcctgcagtgtcaccccgcagtgaag
ttcccttgtgggaggccctggaagcggatggagaagaagcgcagtcacctgaaacgagac
acagaagaccaagaagaccaagtagatccgcggctcattgatgggaagatgaccaggcgg
ggagacagcccctggcaggtggtcctgctggactcaaagaagaagctggcctgcggggca
gtgctcatccacccctcctgggtgctgacagcggcccactgcatggatgagtccaagaag
ctccttgtcaggcttggagagtatgacctgcggcgctgggagaagtgggagctggacctg
gacatcaaggaggtcttcgtccaccccaactacagcaagagcaccaccgacaatgacatc
gcactgctgcacctggcccagcccgccaccctctcgcagaccatagtgcccatctgcctc
ccggacagcggccttgcagagcgcgagctcaatcaggccggccaggagaccctcgtgacg
ggctggggctaccacagcagccgagagaaggaggccaagagaaaccgcaccttcgtcctc
aacttcatcaagattcccgtggtcccgcacaatgagtgcagcgaggtcatgagcaacatg
gtgtctgagaacatgctgtgtgcgggcatcctcggggaccggcaggatgcctgcgagggc
gacagtggggggcccatggtcgcctccttccacggcacctggttcctggtgggcctggtg
agctggggtgagggctgtgggctccttcacaactacggcgtttacaccaaagtcagccgc
tacctcgactggatccatgggcacatcagagacaaggaagccccccagaagagctgggca
ccttag

DBGET integrated database retrieval system