KEGG   Homo sapiens (human): 5625Help
Entry
5625              CDS       T01001                                 

Gene name
PRODH, HSPOX2, PIG6, POX, PRODH1, PRODH2, TP53I6
Definition
(RefSeq) proline dehydrogenase 1 (EC:1.5.5.2)
  KO
K00318  
proline dehydrogenase [EC:1.5.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
Arginine and proline metabolism
Metabolic pathways
Disease
H00190  
Hyperprolinemia (HP)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    5625 (PRODH)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.-  Acting on the CH-NH group of donors
    1.5.-.-  
     5625 (PRODH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q11.21
AA seq 600 aa AA seqDB search
MALRRALPALRPCIPRFVPLSTAPASREQPAAGPAAVPGGGSATAVRPPVPAVDFGNAQE
AYRSRRTWELARSLLVLRLCAWPALLARHEQLLYVSRKLLGQRLFNKLMKMTFYGHFVAG
EDQESIQPLLRHYRAFGVSAILDYGVEEDLSPEEAEHKEMESCTSAAERDGSGTNKRDKQ
YQAHRAFGDRRNGVISARTYFYANEAKCDSHMETFLRCIEASGRVSDDGFIAIKLTALGR
PQFLLQFSEVLAKWRCFFHQMAVEQGQAGLAAMDTKLEVAVLQESVAKLGIASRAEIEDW
FTAETLGVSGTMDLLDWSSLIDSRTKLSKHLVVPNAQTGQLEPLLSRFTEEEELQMTRML
QRMDVLAKKATEMGVRLMVDAEQTYFQPAISRLTLEMQRKFNVEKPLIFNTYQCYLKDAY
DNVTLDVELARREGWCFGAKLVRGAYLAQERARAAEIGYEDPINPTYEATNAMYHRCLDY
VLEELKHNAKAKVMVASHNEDTVRFALRRMEELGLHPADHQVYFGQLLGMCDQISFPLGQ
AGYPVYKYVPYGPVMEVLPYLSRRALENSSLMKGTHRERQLLWLELLRRLRTGNLFHRPA
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atggctctgaggcgcgccctgcccgcgctgcgcccctgcattccccgcttcgtcccgctg
tccacggcgccggcctcccgcgagcagcccgcagcgggcccagcggccgtgccaggaggt
gggtcggccacggcagtgcggccgccggtgcccgccgtggacttcggcaacgcgcaggag
gcgtaccgcagccggcgaacctgggagctggcgcggagcctgctggtgctgcgcttgtgc
gcctggcccgcgctgctggcgcgccacgagcagctgctgtatgtttccaggaaacttcta
ggacagaggctattcaacaagctcatgaagatgaccttctatgggcattttgtagccggg
gaggaccaggagtccatccagcccctgcttcggcactacagggccttcggtgtcagcgcc
atcctggactatggagtggaggaggacctgagccccgaggaggcagagcacaaggagatg
gagtcctgcacctcagctgcggagagggatggcagtggcacgaataagcgggacaagcaa
taccaggcccaccgggccttcggggaccgcaggaatggtgtcatcagtgcccgcacctac
ttctacgccaatgaggccaagtgcgacagccacatggagacattcttgcgctgcatcgaa
gcctcaggtagagtcagcgatgacggcttcatagccattaagctcacagcactggggaga
ccccagtttctgctgcagttctcagaggtgctggccaagtggaggtgcttctttcaccaa
atggctgtggagcaagggcaggcgggcctggctgccatggacaccaagctggaggtggcg
gtgctgcaggaaagtgtcgcaaagttgggcatcgcatccagggctgagattgaggactgg
ttcacggcagagaccctgggagtgtctggcaccatggacctgctggactggagcagcctc
atcgacagcaggaccaagctgtccaagcacttggtagtccccaacgcacagacaggacag
ctggagcccctgctgtcccggttcactgaggaggaggagctacagatgaccaggatgcta
cagcggatggatgtcctggccaagaaagccacagagatgggcgtgcggctgatggtggat
gccgagcagacctacttccagccggccatcagccgcctgacgctggagatgcagcggaag
ttcaatgtggagaagccgctcatcttcaacacataccagtgctacctcaaggatgcctat
gacaatgtgaccctggacgtggagctggctcgccgtgagggctggtgttttggggccaag
ctggtgcggggcgcatacctggcccaggagcgagcccgtgcggcagagatcggctatgag
gaccccatcaaccccacgtacgaggccaccaacgccatgtaccacaggtgcctggactac
gtgttggaggagctgaagcacaacgccaaggccaaggtgatggtggcctcccacaatgag
gacacagtgcgctttgcactgcgcaggatggaggagctgggcctgcatcctgctgaccac
caggtgtactttggacagctgctaggcatgtgtgaccagatcagcttcccgctgggccag
gccggctaccccgtgtacaagtacgtgccctatggccccgtgatggaggtgctgccctac
ttgtcccgccgtgccctggagaacagcagcctcatgaagggcacccatcgggagcggcag
ctgctgtggctggagctcttgaggcggctccgaactggcaacctcttccatcgccctgcc
tag

DBGET integrated database retrieval system