KEGG   Homo sapiens (human): 56288Help
Entry
56288             CDS       T01001                                 

Gene name
PARD3, ASIP, Baz, PAR3, PAR3alpha, PARD-3, PARD3A, PPP1R118, SE2-5L16, SE2-5LT1, SE2-5T2
Definition
(RefSeq) par-3 family cell polarity regulator
  KO
K04237  
partitioning defective protein 3
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Chemokine signaling pathway
Neuroactive ligand-receptor interaction
Endocytosis
Hippo signaling pathway
Adherens junction
Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    56288 (PARD3)
   04390 Hippo signaling pathway
    56288 (PARD3)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    56288 (PARD3)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    56288 (PARD3)
  Cellular commiunity
   04520 Adherens junction
    56288 (PARD3)
   04530 Tight junction
    56288 (PARD3)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    56288 (PARD3)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     56288 (PARD3)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Complement peptide
   Thrombin
    56288 (PARD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10p11.21
AA seq 1356 aa AA seqDB search
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILD
LDDILCDVADDKDRLVAVFDEQDPHHGGDGTSASSTGTQSPEIFGSELGTNNVSAFQPYQ
ATSEIEVTPSVLRANMPLHVRRSSDPALIGLSTSVSDSNFSSEEPSRKNPTRWSTTAGFL
KQNTAGSPKTCDRKKDENYRSLPRDTSNWSNQFQRDNARSSLSASHPMVGKWLEKQEQDE
DGTEEDNSRVEPVGHADTGLEHIPNFSLDDMVKLVEVPNDGGPLGIHVVPFSARGGRTLG
LLVKRLEKGGKAEHENLFRENDCIVRINDGDLRNRRFEQAQHMFRQAMRTPIIWFHVVPA
ANKEQYEQLSQSEKNNYYSSRFSPDSQYIDNRSVNSAGLHTVQRAPRLNHPPEQIDSHSR
LPHSAHPSGKPPSAPASAPQNVFSTTVSSGYNTKKIGKRLNIQLKKGTEGLGFSITSRDV
TIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVVSLLRSTKMEGTV
SLLVFRQEDAFHPRELNAEPSQMQIPKETKAEDEDIVLTPDGTREFLTFEVPLNDSGSAG
LGVSVKGNRSKENHADLGIFVKSIINGGAASKDGRLRVNDQLIAVNGESLLGKTNQDAME
TLRRSMSTEGNKRGMIQLIVARRISKCNELKSPGSPPGPELPIETALDDRERRISHSLYS
GIEGLDESPSRNAALSRIMGESGKYQLSPTVNMPQDDTVIIEDDRLPVLPPHLSDQSSSS
SHDDVGFVTADAGTWAKAAISDSADCSLSPDVDPVLAFQREGFGRQSMSEKRTKQFSDAS
QLDFVKTRKSKSMDLGIADETKLNTVDDQKAGSPSRDVGPSLGLKKSSSLESLQTAVAEV
TLNGDIPFHRPRPRIIRGRGCNESFRAAIDKSYDKPAVDDDDEGMETLEEDTEESSRSGR
ESVSTASDQPSHSLERQMNGNQEKGDKTDRKKDKTGKEKKKDRDKEKDKMKAKKGMLKGL
GDMFRFGKHRKDDKIEKTGKIKIQESFTSEEERIRMKQEQERIQAKTREFRERQARERDY
AEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVKKPRNSKPSP
VDSNRSTPSNHDRIQRLRQEFQQAKQDEDVEDRRRTYSFEQPWPNARPATQSGRHSVSVE
VQMQRQRQEERESSQQAQRQYSSLPRQSRKNASSVSQDSWEQNYSPGEGFQSAKENPRYS
SYQGSRNGYLGGHGFNARVMLETQELLRQEQRRKEQQMKKQPPSEGPSNYDSYKKVQDPS
YAPPKGPFRQDVPPSPSQVARLNRLQTPEKGRPFYS
NT seq 4071 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgaccgtgtgcttcggacggacccgggtggtcgtgccgtgcggggacggccac
atgaaagttttcagcctcatccagcaggcggtgacccgctaccggaaggccatcgccaag
gatccaaactactggatacaggtgcatcgcttggaacatggagatggaggaatactagac
cttgatgacattctttgtgatgtagcagacgataaagacagactggtagcagtgtttgat
gagcaggatccacatcacggaggtgatggcaccagtgccagttccacgggtacccagagc
ccagagatatttggtagtgagcttggcaccaacaatgtctcagcctttcagccttaccaa
gcaacaagtgaaattgaggtcacaccttcagtccttcgagcaaatatgcctcttcatgtt
cgacgcagtagtgacccagctctaattggcctctccacttctgtcagtgatagtaatttt
tcctctgaagagccttcaaggaaaaatcccacacgctggtcaacaacagctggcttcctc
aagcagaacactgctgggagtcctaaaacctgcgacaggaagaaagatgaaaactacaga
agcctcccgcgggatactagtaactggtctaaccaatttcagagagacaatgctcgctcg
tctctgagtgccagtcacccaatggtgggcaagtggctggagaaacaagaacaggatgag
gatgggacagaagaggataacagtcgtgttgaacctgttggacatgctgacacgggtttg
gagcatatacccaacttttctctggatgatatggtaaagctcgtagaagtccccaacgat
ggagggcctctgggaatccatgtagtgcctttcagtgctcgaggcggcagaaccctgggg
ttattagtaaaacgattggagaaaggtggtaaagctgaacatgaaaatctttttcgtgag
aatgattgcattgtcaggattaatgatggcgaccttcgaaatagaagatttgaacaagca
caacatatgtttcgccaagccatgcgtacacccatcatttggttccatgtggttcctgca
gcaaataaagagcagtatgaacaactatcccaaagtgagaagaacaattactattcaagc
cgttttagccctgacagccagtatattgacaacaggagtgtgaacagtgcagggcttcac
acggtgcagagagcaccccgactgaaccacccgcctgagcagatagactctcactcaaga
ctacctcatagcgcacacccctcgggaaaaccaccatccgctccagcctcggcacctcag
aatgtatttagtacgactgtaagcagtggttataacaccaaaaaaataggcaagaggctt
aatatccagcttaagaaaggtacagaaggtttgggattcagcatcacttccagagatgta
acaataggtggctcagctccaatctatgtgaaaaacattctcccccggggggcggccatt
caggatggccgacttaaggcaggagacagacttatagaggtaaatggagtagatttagtg
ggcaaatcccaagaggaagttgtttcgctgttgagaagcaccaagatggaaggaactgtg
agccttctggtctttcgccaggaagacgccttccacccaagggaactgaatgcagagcca
agccagatgcagattccaaaagaaacgaaagcagaagatgaggatattgttcttacacct
gatggcaccagggaatttctgacatttgaagtcccacttaatgattcaggatctgcaggc
cttggtgtcagtgtcaaaggtaaccggtcaaaagagaaccacgcagatttgggaatcttt
gtcaagtccattattaatggaggagcagcatctaaagatggaaggcttcgggtgaatgat
caactgatagcagtaaatggagaatccctgttgggcaagacaaaccaagatgccatggaa
accctaagaaggtctatgtctactgaaggcaataaacgaggaatgatccagcttattgtt
gcaaggagaataagcaagtgcaatgagctgaagtcacctgggagcccccctggacctgag
ctgcccattgaaacagcgttggatgatagagaacgaagaatttcccattccctctacagt
gggattgaggggcttgatgaatcgcccagcagaaatgctgccctcagtaggataatgggt
gagtcaggtaaataccagctgtcccctacagtgaatatgccccaagatgacactgtcatt
atagaagatgacaggttgccagtgcttcctccacatctctctgaccagtcctcttccagc
tcccatgatgatgtggggtttgtgacggcagatgctggtacttgggccaaggctgcaatc
agtgattcagccgactgctctttgagtccagatgttgatccagttcttgcttttcaacga
gaaggatttggacgtcagagtatgtcagaaaaacgcacaaagcaattttcagatgccagt
caattggatttcgttaaaacacgaaaatcaaaaagcatggatttaggtatagctgacgag
actaaactcaatacagtggatgaccagaaagcaggttctcccagcagagatgtgggtcct
tccctgggtctgaagaagtcaagctcgttggagagtctgcagaccgcagttgccgaggtg
actttgaatggggatattcctttccatcgtccacggccgcggataatcagaggcagggga
tgcaatgagagcttcagagctgccatcgacaaatcttatgataaacccgcggtagatgat
gatgatgaaggcatggagaccttggaagaagacacagaagaaagttcaagatcagggaga
gagtctgtatccacagccagtgatcagccttcccactctctggagagacaaatgaatgga
aaccaagagaaaggtgataagactgatagaaaaaaggataaaactggaaaagaaaagaag
aaagatagagataaggagaaggataaaatgaaagccaagaagggaatgctgaagggcttg
ggagacatgttcaggtttggcaaacatcgaaaagatgacaagattgagaaaacgggtaaa
ataaaaatacaggaatcctttacatcagaagaggagaggatacgaatgaagcaggagcag
gagaggattcaagccaaaactcgagaatttagggaacgacaagctcgagagcgtgactat
gctgaaattcaagattttcatcggacatttggctgtgatgatgagttaatgtatggggga
gtttcttcttatgaaggttccatggctctcaacgctagacctcagagcccacgagaaggg
catatgatggatgctttgtatgcccaagtcaagaagccgcggaattccaaaccctcacct
gtagacagtaacagatcaactcctagcaatcatgatcggatacagcgtctgaggcaagaa
tttcagcaagcaaagcaagatgaagatgtagaagatcgtcggcggacctatagttttgag
caaccctggccgaacgcacggccggcgacgcagagcgggcgacactcggtgtccgtggag
gtgcagatgcagcggcagcggcaggaggagcgcgagagctcccagcaggcccagcgccag
tacagctctctgcctcggcaaagcaggaaaaatgccagctcggtctcccaggactcttgg
gagcagaactactcccctggggaaggcttccagagtgccaaagagaaccccaggtactcc
agctaccaaggctccaggaacggctacctgggaggacatggcttcaacgccagggtcatg
ctggaaactcaggagctccttcgccaggaacagaggcggaaggagcagcagatgaagaag
cagcctccttccgaggggcccagcaactatgactcgtataagaaagtccaggaccccagt
tacgcccctcccaaggggcccttccggcaagatgtgcccccctccccttctcaggttgcg
aggctgaacagacttcagactcctgagaaagggaggcccttctattcctga

DBGET integrated database retrieval system