KEGG   Homo sapiens (human): 563Help
Entry
563               CDS       T01001                                 

Gene name
AZGP1, ZA2G, ZAG
Definition
(RefSeq) alpha-2-glycoprotein 1, zinc-binding
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q22.1
AA seq 298 aa AA seqDB search
MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQALGSLNDLQFFR
YNSKDRKSQPMGLWRQVEGMEDWKQDSQLQKAREDIFMETLKDIVEYYNDSNGSHVLQGR
FGCEIENNRSSGAFWKYYYDGKDYIEFNKEIPAWVPFDPAAQITKQKWEAEPVYVQRAKA
YLEEECPATLRKYLKYSKNILDRQDPPSVVVTSHQAPGEKKKLKCLAYDFYPGKIDVHWT
RAGEVQEPELRGDVLHNGNGTYQSWVVVAVPPQDTAPYSCHVQHSSLAQPLVVPWEAS
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggtaagaatggtgcctgtcctgctgtctctgctgctgcttctgggtcctgctgtcccc
caggagaaccaagatggtcgttactctctgacctatatctacactgggctgtccaagcat
gttgaagacgtccccgcgtttcaggcccttggctcactcaatgacctccagttctttaga
tacaacagtaaagacaggaagtctcagcccatgggactctggagacaggtggaaggaatg
gaggattggaagcaggacagccaacttcagaaggccagggaggacatctttatggagacc
ctgaaagacatcgtggagtattacaacgacagtaacgggtctcacgtattgcagggaagg
tttggttgtgagatcgagaataacagaagcagcggagcattctggaaatattactatgat
ggaaaggactacattgaattcaacaaagaaatcccagcctgggtccccttcgacccagca
gcccagataaccaagcagaagtgggaggcagaaccagtctacgtgcagcgggccaaggct
tacctggaggaggagtgccctgcgactctgcggaaatacctgaaatacagcaaaaatatc
ctggaccggcaagatcctccctctgtggtggtcaccagccaccaggccccaggagaaaag
aagaaactgaagtgcctggcctacgacttctacccagggaaaattgatgtgcactggact
cgggccggcgaggtgcaggagcctgagttacggggagatgttcttcacaatggaaatggc
acttaccagtcctgggtggtggtggcagtgcccccgcaggacacagccccctactcctgc
cacgtgcagcacagcagcctggcccagcccctcgtggtgccctgggaggccagctag

DBGET integrated database retrieval system