KEGG   Homo sapiens (human): 5630Help
Entry
5630              CDS       T01001                                 

Gene name
PRPH, NEF4, PRPH1
Definition
peripherin
Orthology
K07607  
peripherin
Organism
hsa  Homo sapiens (human)
Pathway
Amyotrophic lateral sclerosis (ALS)
Disease
H00058  
Amyotrophic lateral sclerosis (ALS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    5630 (PRPH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
12q12-q13
AA seq 470 aa AA seqDB search
MSHHPSGLRAGFSSTSYRRTFGPPPSLSPGAFSYSSSSRFSSSRLLGSASPSSSVRLGSF
RSPRAGAGALLRLPSERLDFSMAEALNQEFLATRSNEKQELQELNDRFANFIEKVRFLEQ
QNAALRGELSQARGQEPARADQLCQQELRELRRELELLGRERDRVQVERDGLAEDLAALK
QRLEEETRKREDAEHNLVLFRKDVDDATLSRLELERKIESLMDEIEFLKKLHEEELRDLQ
VSVESQQVQQVEVEATVKPELTAALRDIRAQYESIAAKNLQEAEEWYKSKYADLSDAANR
NHEALRQAKQEMNESRRQIQSLTCEVDGLRGTNEALLRQLRELEEQFALEAGGYQAGAAR
LEEELRQLKEEMARHLREYQELLNVKMALDIEIATYRKLLEGEESRISVPVHSFASLNIK
TTVPEVEPPQDSHSRKTVLIKTIETRNGEVVTESQKEQRSELDKSSAHSY
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgagccaccacccgtcgggcctccgggccggcttcagctccacctcataccgccgtacc
ttcggtccaccgccctcactatcccccggggccttctcctactcgtccagctcccgcttc
tccagcagccgcctgctgggctccgcgtccccgagctcctcggtgcgcctgggcagcttc
cgtagcccccgagcgggagcgggcgccctcctgcgcctgccctcggagcgcctcgacttc
tccatggccgaggccctcaaccaggagttcctggccacgcgcagcaacgagaagcaggag
ctgcaggagctcaacgaccgcttcgccaacttcatcgagaaggtacgctttctggagcag
cagaacgcggccctgcgcggggagctgagccaagcccggggccaggagccggcgcgcgcc
gaccagctgtgccagcaggagctgcgcgagctgcggcgagagctggagctgttgggccgc
gagcgtgaccgggtgcaggtggagcgcgacgggctggcggaggacctggcggcgctcaag
cagaggttggaggaggagacgcgcaagcgggaggacgcggagcacaacctcgtgctcttc
cgcaaggacgtggacgatgccactctgtcccgcctggaactagagcgcaagattgagtct
ctgatggatgagattgagttcctcaagaagctgcacgaggaggagctgcgagacctgcag
gtgagtgtggagagccagcaggtgcagcaggtggaggtggaagccacggtgaagcccgag
ctgacggcagcgctgagggacatccgcgcgcagtacgagagcatcgccgcgaagaacctg
caggaggcggaggagtggtacaagtccaagtacgcggacctgtccgacgctgccaaccgg
aaccacgaggccctgcgccaggccaagcaggagatgaacgagtcccgacgccagatccag
agtctaacgtgcgaggtggacgggctgcgcggcacgaacgaggcgctgctcaggcagttg
agagagctggaggagcagttcgccctggaggcggggggctaccaggcgggcgctgcgcgg
ctcgaggaggagctgcgacagctaaaagaggagatggcgcggcacctgagggagtaccag
gagctcctcaacgtcaagatggccctggacatcgagatcgccacctaccgcaagctgctg
gagggcgaggagagccggatctccgtgcccgtccattcttttgcctccttaaatataaag
acgactgtgcctgaggtggagcctccccaggacagccacagccggaagacggttctgatc
aagaccattgagacccggaatggggaggtggtgacagagtcccagaaggagcagcgcagt
gagctggacaagtcttctgcccacagttactga

DBGET integrated database retrieval system