KEGG   Homo sapiens (human): 56302Help
Entry
56302             CDS       T01001                                 

Gene name
TRPV5, CAT2, ECAC1, OTRPC3
Definition
(RefSeq) transient receptor potential cation channel subfamily V member 5
  KO
K04974  transient receptor potential cation channel subfamily V member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04961  Endocrine and other factor-regulated calcium reabsorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    56302 (TRPV5)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    56302 (TRPV5)
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPV (Vanilloid)
   56302 (TRPV5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ion_trans Ank_3 Ank Ank_4 Ank_5
Motif
Other DBs
NCBI-GeneID: 56302
NCBI-ProteinID: NP_062815
OMIM: 606679
HGNC: 3145
Ensembl: ENSG00000127412
Vega: OTTHUMG00000157157
Pharos: Q9NQA5(Tbio)
UniProt: Q9NQA5 A0A0A6YY98
Structure
PDB: 

Jmol
Position
7q34
AA seq 729 aa AA seqDB search
MGGFLPKAEGPGSQLQKLLPSFLVREQDWDQHLDKLHMLQQKRILESPLLRASKENDLSV
LRQLLLDCTCDVRQRGALGETALHIAALYDNLEAALVLMEAAPELVFEPTTCEAFAGQTA
LHIAVVNQNVNLVRALLTRRASVSARATGTAFRHSPRNLIYFGEHPLSFAACVNSEEIVR
LLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDGHGDHLQPLDLVPNHQG
LTPFKLAGVEGNTVMFQHLMQKRRHIQWTYGPLTSILYDLTEIDSWGEELSFLELVVSSD
KREARQILEQTPVKELVSFKWNKYGRPYFCILAALYLLYMICFTTCCVYRPLKFRGGNRT
HSRDITILQQKLLQEAYETREDIIRLVGELVSIVGAVIILLLEIPDIFRVGASRYFGKTI
LGGPFHVIIITYASLVLVTMVMRLTNTNGEVVPMSFALVLGWCSVMYFTRGFQMLGPFTI
MIQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPTSLGQFYDYPMALFTTFELFLTV
IDAPANYDVDLPFMFSIVNFAFTIIATLLMLNLFIAMMGDTHWRVAQERDELWRAQVVAT
TVMLERKLPRCLWPRSGICGCEFGLGDRWFLRVENHNDQNPLRVLRYVEVFKNSDKEDDQ
EHPSEKQPSGAESGTLARASLALPTSSLSRTASQSSSHRGWEILRQNTLGHLNLGLNLSE
GDGEEVYHF
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atggggggttttctacctaaggcagaagggcccgggagccaactccagaaacttctgccc
tcctttctggtcagagaacaagactgggaccagcacctggacaagcttcatatgctgcag
cagaagaggattctagagtctccactgcttcgagcatccaaggaaaatgacctgtctgtt
cttaggcaacttctactggactgcacctgtgacgttcgacaaagaggagccctgggggag
acggcgctgcacatagcagccctctatgacaacttggaggcggccttggtgctgatggag
gctgccccagagctggtctttgagcccaccacatgtgaggcttttgcaggtcagactgca
ctgcacatcgctgttgtgaaccagaatgtgaacctggtgcgtgccctgctcacccgcagg
gccagtgtctctgccagagccacaggcactgccttccgccatagtccccgcaacctcatc
tactttggggagcaccctttgtcctttgctgcctgtgtgaacagcgaggagatcgtgcgg
ctgctcattgagcatggagctgacatcagggcccaggactccctgggaaacacagtatta
cacatcctcatcctccagcccaacaaaacctttgcctgccagatgtacaacctgctgctg
tcctatgatggacatggggaccacctgcagcccctggaccttgtgcccaatcaccagggt
ctcacccccttcaagctggctggagtggagggtaacactgtgatgttccagcacctgatg
cagaagcggaggcacatccagtggacgtatggacccctgacctccattctctacgacctc
acggagatcgactcctggggagaggagctgtccttcctggagcttgtggtctcctctgat
aaacgagaggctcgccaaattctggaacagaccccagtgaaggagctggtgagcttcaag
tggaacaagtatggccggccgtacttctgcatcctggctgccttgtacctgctctacatg
atctgctttactacgtgctgcgtctaccgcccccttaagtttcgtggtggcaaccgcact
cattctcgagacatcaccatcctccagcaaaaactactacaggaggcctatgagacacgt
gaagatatcatcaggctggtgggggagctggtgagcatcgttggggctgtgatcatcctg
ctcctagagattccagacatcttcagggttggtgcctctcgctattttggaaagacgatt
cttggggggccattccatgtcatcatcatcacctatgcctccctggtgctggtgaccatg
gtgatgcggctcaccaacaccaatggggaggtggtgcccatgtcctttgccctggtgctg
ggctggtgcagtgtcatgtatttcactcgaggattccagatgctgggtcccttcaccatc
atgatccagaagatgatttttggagacctaatgcgtttctgctggctgatggctgtggtc
atcttgggatttgcctccgcgttctatatcattttccagacagaggacccaaccagtctg
gggcaattctatgactaccccatggcactgttcaccacctttgagctttttctcactgtt
attgatgcacctgccaactacgacgtggacttgcccttcatgttcagcattgtcaacttc
gccttcaccatcattgccacactgctcatgctcaacttgttcatcgccatgatgggcgac
acccactggagggtggcccaggagagggatgagctctggagggcccaggtcgtggccacc
acagtgatgctggagcggaagctgcctcgctgcctgtggcctcgctccgggatctgtggg
tgcgaattcgggctgggggaccgctggttcctgcgggttgagaaccacaatgatcagaat
cctctgcgagtgcttcgctatgtggaagtgttcaagaactcagacaaggaggatgaccag
gagcatccatctgagaaacagccctctggggctgagagtgggactctagccagagcctct
ttggctcttccaacttcctccctgtcccggaccgcgtcccagagcagcagtcaccgaggc
tgggagatccttcgtcaaaacaccctggggcacttgaatcttggactgaaccttagtgag
ggggatggagaggaggtctaccatttttga

DBGET integrated database retrieval system