KEGG   Homo sapiens (human): 56413Help
Entry
56413             CDS       T01001                                 

Gene name
LTB4R2, BLT2, BLTR2, JULF2, KPG_004, LTB4-R_2, LTB4-R2, NOP9
Definition
leukotriene B4 receptor 2
Orthology
K04297  
leukotriene B4 receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    56413 (LTB4R2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    56413 (LTB4R2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Lipid
   Leukotriene
    56413 (LTB4R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q12
AA seq 358 aa AA seqDB search
MSVCYRPPGNETLLSWKTSRATGTAFLLLAALLGLPGNGFVVWSLAGWRPARGRPLAATL
VLHLALADGAVLLLTPLFVAFLTRQAWPLGQAGCKAVYYVCALSMYASVLLTGLLSLQRC
LAVTRPFLAPRLRSPALARRLLLAVWLAALLLAVPAAVYRHLWRDRVCQLCHPSPVHAAA
HLSLETLTAFVLPFGLMLGCYSVTLARLRGARWGSGRHGARVGRLVSAIVLAFGLLWAPY
HAVNLLQAVAALAPPEGALAKLGGAGQAARAGTTALAFFSSSVNPVLYVFTAGDLLPRAG
PRFLTRLFEGSGEARGGGRSREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGPEWDL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtctgctaccgtcccccagggaacgagacactgctgagctggaagacttcgcgg
gccacaggcacagccttcctgctgctggcggcgctgctggggctgcctggcaacggcttc
gtggtgtggagcttggcgggctggcggcctgcacgggggcgaccgctggcggccacgctt
gtgctgcacctggcgctggccgacggcgcggtgctgctgctcacgccgctctttgtggcc
ttcctgacccggcaggcctggccgctgggccaggcgggctgcaaggcggtgtactacgtg
tgcgcgctcagcatgtacgccagcgtgctgctcaccggcctgctcagcctgcagcgctgc
ctcgcagtcacccgccccttcctggcgcctcggctgcgcagcccggccctggcccgccgc
ctgctgctggcggtctggctggccgccctgttgctcgccgtcccggccgccgtctaccgc
cacctgtggagggaccgcgtatgccagctgtgccacccgtcgccggtccacgccgccgcc
cacctgagcctggagactctgaccgctttcgtgcttcctttcgggctgatgctcggctgc
tacagcgtgacgctggcacggctgcggggcgcccgctggggctccgggcggcacggggcg
cgggtgggccggctggtgagcgccatcgtgcttgccttcggcttgctctgggccccctac
cacgcagtcaaccttctgcaggcggtcgcagcgctggctccaccggaaggggccttggcg
aagctgggcggagccggccaggcggcgcgagcgggaactacggccttggccttcttcagt
tctagcgtcaacccggtgctctacgtcttcaccgctggagatctgctgccccgggcaggt
ccccgtttcctcacgcggctcttcgaaggctctggggaggcccgagggggcggccgctct
agggaagggaccatggagctccgaactacccctcagctgaaagtggtggggcagggccgc
ggcaatggagacccggggggtgggatggagaaggacggtccggaatgggacctttga

DBGET integrated database retrieval system