KEGG   Homo sapiens (human): 56413Help
Entry
56413             CDS       T01001                                 

Gene name
LTB4R2, BLT2, BLTR2, JULF2, KPG_004, LTB4-R_2, LTB4-R2, NOP9
Definition
(RefSeq) leukotriene B4 receptor 2
  KO
K04297  leukotriene B4 receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Etalocib: D04074
Moxilubant maleate: D05085
Ticolubant: D06140
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    56413 (LTB4R2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    56413 (LTB4R2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Lipid
   Leukotriene
    56413 (LTB4R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 56413
NCBI-ProteinID: NP_001158164
OMIM: 605773
HGNC: 19260
Ensembl: ENSG00000213906
Vega: OTTHUMG00000186500
Pharos: Q9NPC1(Tchem)
UniProt: Q9NPC1 B4E292
Position
14q12
AA seq 358 aa AA seqDB search
MSVCYRPPGNETLLSWKTSRATGTAFLLLAALLGLPGNGFVVWSLAGWRPARGRPLAATL
VLHLALADGAVLLLTPLFVAFLTRQAWPLGQAGCKAVYYVCALSMYASVLLTGLLSLQRC
LAVTRPFLAPRLRSPALARRLLLAVWLAALLLAVPAAVYRHLWRDRVCQLCHPSPVHAAA
HLSLETLTAFVLPFGLMLGCYSVTLARLRGARWGSGRHGARVGRLVSAIVLAFGLLWAPY
HAVNLLQAVAALAPPEGALAKLGGAGQAARAGTTALAFFSSSVNPVLYVFTAGDLLPRAG
PRFLTRLFEGSGEARGGGRSREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGPEWDL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtctgctaccgtcccccagggaacgagacactgctgagctggaagacttcgcgg
gccacaggcacagccttcctgctgctggcggcgctgctggggctgcctggcaacggcttc
gtggtgtggagcttggcgggctggcggcctgcacgggggcgaccgctggcggccacgctt
gtgctgcacctggcgctggccgacggcgcggtgctgctgctcacgccgctctttgtggcc
ttcctgacccggcaggcctggccgctgggccaggcgggctgcaaggcggtgtactacgtg
tgcgcgctcagcatgtacgccagcgtgctgctcaccggcctgctcagcctgcagcgctgc
ctcgcagtcacccgccccttcctggcgcctcggctgcgcagcccggccctggcccgccgc
ctgctgctggcggtctggctggccgccctgttgctcgccgtcccggccgccgtctaccgc
cacctgtggagggaccgcgtatgccagctgtgccacccgtcgccggtccacgccgccgcc
cacctgagcctggagactctgaccgctttcgtgcttcctttcgggctgatgctcggctgc
tacagcgtgacgctggcacggctgcggggcgcccgctggggctccgggcggcacggggcg
cgggtgggccggctggtgagcgccatcgtgcttgccttcggcttgctctgggccccctac
cacgcagtcaaccttctgcaggcggtcgcagcgctggctccaccggaaggggccttggcg
aagctgggcggagccggccaggcggcgcgagcgggaactacggccttggccttcttcagt
tctagcgtcaacccggtgctctacgtcttcaccgctggagatctgctgccccgggcaggt
ccccgtttcctcacgcggctcttcgaaggctctggggaggcccgagggggcggccgctct
agggaagggaccatggagctccgaactacccctcagctgaaagtggtggggcagggccgc
ggcaatggagacccggggggtgggatggagaaggacggtccggaatgggacctttga

DBGET integrated database retrieval system