KEGG   Homo sapiens (human): 56474Help
Entry
56474             CDS       T01001                                 

Gene name
CTPS2
Definition
CTP synthase 2 (EC:6.3.4.2)
Orthology
K01937  
CTP synthase [EC:6.3.4.2]
Organism
hsa  Homo sapiens (human)
Pathway
Pyrimidine metabolism
Metabolic pathways
Module
Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hsa00240]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp22
AA seq 586 aa AA seqDB search
MKYILVTGGVISGIGKGIIASSIGTILKSCGLRVTAIKIDPYINIDAGTFSPYEHGEVFV
LNDGGEVDLDLGNYERFLDINLYKDNNITTGKIYQHVINKERRGDYLGKTVQVVPHITDA
VQEWVMNQAKVPVDGNKEEPQICVIELGGTIGDIEGMPFVEAFRQFQFKAKRENFCNIHV
SLVPQLSATGEQKTKPTQNSVRALRGLGLSPDLIVCRSSTPIEMAVKEKISMFCHVNPEQ
VICIHDVSSTYRVPVLLEEQSIVKYFKERLHLPIGDSASNLLFKWRNMADRYERLQKICS
IALVGKYTKLRDCYASVFKALEHSALAINHKLNLMYIDSIDLEKITETEDPVKFHEAWQK
LCKADGILVPGGFGIRGTLGKLQAISWARTKKIPFLGVCLGMQLAVIEFARNCLNLKDAD
STEFRPNAPVPLVIDMPEHNPGNLGGTMRLGIRRTVFKTENSILRKLYGDVPFIEERHRH
RFEVNPNLIKQFEQNDLSFVGQDVDGDRMEIIELANHPYFVGVQFHPEFSSRPMKPSPPY
LGLLLAATGNLNAYLQQGCKLSSSDRYSDASDDSFSEPRIAELEIS
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacatcctggtcacgggtggggtcatctcaggcattggtaaagggatcattgcc
agcagcattggaacgattctaaaatcatgtggactccgagttactgccataaaaatcgac
ccctatattaacatcgatgctggcactttttcaccttatgaacacggtgaagtcttcgtc
ttaaatgatggtggagaagttgatttagaccttggaaattatgaaagatttttggatatt
aatctttataaagacaacaatatcaccacggggaagatatatcagcatgtgatcaataaa
gagaggcgtggtgattacctggggaaaacagtgcaagttgtccctcacattactgatgct
gtccaggagtgggttatgaatcaagccaaggtgccggtggatggtaataaggaagagccc
caaatatgcgttattgagctgggaggcaccattggagacatcgaaggaatgccgtttgtg
gaggcgtttagacaattccagtttaaggcgaaaagagagaatttctgtaatatccacgtt
agccttgtcccacagctcagtgctaccggagaacaaaaaaccaaacccacccaaaacagc
gtccgcgcactgaggggtttaggcctgtctccagatctgattgtctgccgaagttcaacg
cccattgagatggccgtgaaggagaagatttctatgttttgtcacgtgaaccctgaacag
gtcatatgtatccatgatgtttcttccacataccgagttcctgtgcttttagaggaacaa
agcattgtgaaatattttaaggagagattgcacctgcccatcggtgattctgcaagtaat
ttgctttttaagtggagaaatatggctgacaggtatgaaaggttacagaaaatatgctcc
atagccctggttggcaaatacaccaagctcagagactgctacgcctctgtgttcaaagcc
ctggaacactcagccctggccatcaaccacaagttgaatctgatgtacatagactccatt
gatctggagaagatcactgaaaccgaggaccctgtgaaatttcatgaagcttggcagaag
ctatgcaaagctgatggtattcttgtgcctggaggctttggaatcagaggaacattggga
aaactccaggcgatttcttgggcaaggacaaagaagattccttttctgggagtttgtctt
gggatgcaactagcagtgatagagtttgcaagaaactgccttaacttgaaagatgctgat
tccacagagtttaggccaaatgccccagttcctctggtgattgatatgcccgagcacaac
cctggcaatttgggaggaacaatgagactgggaataagaagaactgttttcaaaactgaa
aattcaatattaaggaaactttatggtgatgttccttttatagaagaaagacacagacat
cggttcgaggtaaaccctaacctgatcaaacaatttgagcagaatgacttaagttttgta
ggtcaggatgttgatggagacaggatggaaatcattgaactggcaaatcatccttatttt
gttggtgtccagttccatcctgagttttcttctaggccgatgaagccttcccctccgtat
ctggggctgttacttgcagcaactgggaacctgaatgcctacttgcaacagggttgcaaa
ctgtcttccagtgatagatacagtgatgccagtgatgacagcttttcagagccaaggata
gctgagttggaaataagctga

DBGET integrated database retrieval system