KEGG   Homo sapiens (human): 56477Help
Entry
56477             CDS       T01001                                 

Gene name
CCL28, CCK1, MEC, SCYA28
Definition
chemokine (C-C motif) ligand 28
Orthology
K05513  
C-C motif chemokine 28
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    56477 (CCL28)
 Organismal Systems
  Immune system
   04672 Intestinal immune network for IgA production
    56477 (CCL28)
   04062 Chemokine signaling pathway
    56477 (CCL28)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
5p12
AA seq 127 aa AA seqDB search
MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDL
AAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHET
YGHKTPY
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagagaggactcgccatcgtggccttggctgtctgtgcggccctacatgcctca
gaagccatacttcccattgcctccagctgttgcacggaggtttcacatcatatttccaga
aggctcctggaaagagtgaatatgtgtcgcatccagagagctgatggggattgtgacttg
gctgctgtcatccttcatgtcaagcgcagaagaatctgtgtcagcccgcacaaccatact
gttaagcagtggatgaaagtgcaagctgccaagaaaaatggtaaaggaaatgtttgccac
aggaagaaacaccatggcaagaggaacagtaacagggcacatcaggggaaacacgaaaca
tacggccataaaactccttattag

DBGET integrated database retrieval system