KEGG   Homo sapiens (human): 56479Help
Entry
56479             CDS       T01001                                 

Gene name
KCNQ5, Kv7.5
Definition
potassium voltage-gated channel, KQT-like subfamily, member 5
Orthology
K04930  
potassium voltage-gated channel KQT-like subfamily member 5
Organism
hsa  Homo sapiens (human)
Pathway
Cholinergic synapse
Drug target
Retigabine: 
Linopirdine: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    56479 (KCNQ5)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNQ, Kv7.x (KQT-like)
   56479 (KCNQ5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q14
AA seq 923 aa AA seqDB search
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLL
LGTRAATLGGGGGGLRESRRGKQGARMSLLGKPLSYTSSQSCRRNVKYRRVQNYLYNVLE
RPRGWAFIYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIW
SAGCCCRYRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQIL
RMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLVLIFSSFLVYLVEKDANKEFSTYAD
ALWWGTITLTTIGYGDKTPLTWLGRLLSAGFALLGISFFALPAGILGSGFALKVQEQHRQ
KHFEKRRNPAANLIQCVWRSYAADEKSVSIATWKPHLKALHTCSPTNQKLSFKERVRMAS
PRGQSIKSRQASVGDRRSPSTDITAEGSPTKVQKSWSFNDRTRFRPSLRLKSSQPKPVID
ADTALGTDDVYDEKGCQCDVSVEDLTPPLKTVIRAIRIMKFHVAKRKFKETLRPYDVKDV
IEQYSAGHLDMLCRIKSLQTRVDQILGKGQITSDKKSREKITAEHETTDDLSMLGRVVKV
EKQVQSIESKLDCLLDIYQQVLRKGSASALALASFQIPPFECEQTSDYQSPVDSKDLSGS
AQNSGCLSRSTSANISRGLQFILTPNEFSAQTFYALSPTMHSQATQVPISQSDGSAVAAT
NTIANQINTAPKPAAPTTLQIPPPLPAIKHLPRPETLHPNPAGLQESISDVTTCLVASKE
NVQVAQSNLTKDRSMRKSFDMGGETLLSVCPMVPKDLGKSLSVQNLIRSTEELNIQLSGS
ESSGSRGSQDFYPKWRESKLFITDEEVGPEETETDTFDAAPQPAREAAFASDSLRTGRSR
SSQSICKAGESTDALSLPHVKLK
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgccccgccaccacgcgggaggagaggagggcggcgccgccgggctctgggtgaagagc
ggcgcagcggcggcggcggcgggcggggggcgcttgggcagcggcatgaaggatgtggag
tccggccggggcagggtgctgctgaactcggcagccgccaggggcgacggcctgctactg
ctgggcacccgcgcggccacgctcggtggcggcggcggtggcctgagggagagccgccgg
ggcaagcagggggcccggatgagcctgctggggaagccgctctcttacacgagtagccag
agctgccggcgcaacgtcaagtaccggcgggtgcagaactacctgtacaacgtgctggag
agaccccgcggctgggcgttcatctaccacgctttcgtttttctccttgtctttggttgc
ttgattttgtcagtgttttctaccatccctgagcacacaaaattggcctcaagttgcctc
ttgatcctggagttcgtgatgattgtcgtctttggtttggagttcatcattcgaatctgg
tctgcgggttgctgttgtcgatatagaggatggcaaggaagactgaggtttgctcgaaag
cccttctgtgttatagataccattgttcttatcgcttcaatagcagttgtttctgcaaaa
actcagggtaatatttttgccacgtctgcactcagaagtctccgtttcctacagatcctc
cgcatggtgcgcatggaccgaaggggaggcacttggaaattactgggttcagtggtttat
gctcacagcaaggaattaatcacagcttggtacataggatttttggttcttattttttcg
tctttccttgtctatctggtggaaaaggatgccaataaagagttttctacatatgcagat
gctctctggtggggcacaattacattgacaactattggctatggagacaaaactccccta
acttggctgggaagattgctttctgcaggctttgcactccttggcatttctttctttgca
cttcctgccggcattcttggctcaggttttgcattaaaagtacaagaacaacaccgccag
aaacactttgagaaaagaaggaacccagctgccaacctcattcagtgtgtttggcgtagt
tacgcagctgatgagaaatctgtttccattgcaacctggaagccacacttgaaggccttg
cacacctgcagccctaccaatcagaagctaagttttaaggagcgagtgcgcatggctagc
cccaggggccagagtattaagagccgacaagcctcagtaggtgacaggaggtccccaagc
accgacatcacagccgagggcagtcccaccaaagtgcagaagagctggagcttcaacgac
cgaacccgcttccggccctcgctgcgcctcaaaagttctcagccaaaaccagtgatagat
gctgacacagcccttggcactgatgatgtatatgatgaaaaaggatgccagtgtgatgta
tcagtggaagacctcaccccaccacttaaaactgtcattcgagctatcagaattatgaaa
tttcatgttgcaaaacggaagtttaaggaaacattacgtccatatgatgtaaaagatgtc
attgaacaatattctgctggtcatctggacatgttgtgtagaattaaaagccttcaaaca
cgtgttgatcaaattcttggaaaagggcaaatcacatcagataagaagagccgagagaaa
ataacagcagaacatgagaccacagacgatctcagtatgctcggtcgggtggtcaaggtt
gaaaaacaggtacagtccatagaatccaagctggactgcctactagacatctatcaacag
gtccttcggaaaggctctgcctcagccctcgctttggcttcattccagatcccacctttt
gaatgtgaacagacatctgactatcaaagccctgtggatagcaaagatctttcgggttcc
gcacaaaacagtggctgcttatccagatcaactagtgccaacatctcgagaggcctgcag
ttcattctgacgccaaatgagttcagtgcccagactttctacgcgcttagccctactatg
cacagtcaagcaacacaggtgccaattagtcaaagcgatggctcagcagtggcagccacc
aacaccattgcaaaccaaataaatacggcacccaagccagcagccccaacaactttacag
atcccacctcctctcccagccatcaagcatctgcccaggccagaaactctgcaccctaac
cctgcaggcttacaggaaagcatttctgacgtcaccacctgccttgttgcctccaaggaa
aatgttcaggttgcacagtcaaatctcaccaaggaccgttctatgaggaaaagctttgac
atgggaggagaaactctgttgtctgtctgtcccatggtgccgaaggacttgggcaaatct
ttgtctgtgcaaaacctgatcaggtcgaccgaggaactgaatatacaactttcagggagt
gagtcaagtggctccagaggcagccaagatttttaccccaaatggagggaatccaaattg
tttataactgatgaagaggtgggtcccgaagagacagagacagacacttttgatgccgca
ccgcagcctgccagggaagctgcctttgcatcagactctctaaggactggaaggtcacga
tcatctcagagcatttgtaaggcaggagaaagtacagatgccctcagcttgcctcatgtc
aaactgaaataa

DBGET integrated database retrieval system