KEGG   Homo sapiens (human): 5648Help
Entry
5648              CDS       T01001                                 

Gene name
MASP1, 3MC1, CRARF, CRARF1, MAP1, MASP, MASP3, MAp44, PRSS5, RaRF
Definition
mannan-binding lectin serine peptidase 1 (C4/C2 activating component of Ra-reactive factor) (EC:3.4.21.-)
Orthology
K03992  
mannan-binding lectin serine protease 1 [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Staphylococcus aureus infection
Class
Organismal Systems; Immune system; Complement and coagulation cascades [PATH:hsa04610]
Human Diseases; Infectious diseases; Staphylococcus aureus infection [PATH:hsa05150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q27-q28
AA seq 380 aa AA seqDB search
MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKL
YFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRS
DFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRT
CRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEV
PCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNE
CPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIP
TCKKNEIDLESELKSEQVTE
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggctgcttctctattatgctctgtgcttctccctgtcaaaggcttcagcccac
accgtggagctaaacaatatgtttggccagatccagtcgcctggttatccagactcctat
cccagtgattcagaggtgacttggaatatcactgtcccagatgggtttcggatcaagctt
tacttcatgcacttcaacttggaatcctcctacctttgtgaatatgactatgtgaaggta
gaaactgaggaccaggtgctggcaaccttctgtggcagggagaccacagacacagagcag
actcccggccaggaggtggtcctctcccctggctccttcatgtccatcactttccggtca
gatttctccaatgaggagcgtttcacaggctttgatgcccactacatggctgtggatgtg
gacgagtgcaaggagagggaggacgaggagctgtcctgtgaccactactgccacaactac
attggcggctactactgctcctgccgcttcggctacatcctccacacagacaacaggacc
tgccgagtggagtgcagtgacaacctcttcactcaaaggactggggtgatcaccagccct
gacttcccaaacccttaccccaagagctctgaatgcctgtataccatcgagctggaggag
ggtttcatggtcaacctgcagtttgaggacatatttgacattgaggaccatcctgaggtg
ccctgcccctatgactacatcaagatcaaagttggtccaaaagttttggggcctttctgt
ggagagaaagccccagaacccatcagcacccagagccacagtgtcctgatcctgttccat
agtgacaactcgggagagaaccggggctggaggctctcatacagggctgcaggaaatgag
tgcccagagctacagcctcctgtccatgggaaaatcgagccctcccaagccaagtatttc
ttcaaagaccaagtgctcgtcagctgtgacacaggctacaaagtgctgaaggataatgtg
gagatggacacattccagattgagtgtctgaaggatgggacgtggagtaacaagattccc
acctgtaaaaaaaatgaaatcgatctggagagcgaactcaagtcagagcaagtgacagag
tga

DBGET integrated database retrieval system