KEGG   Homo sapiens (human): 5650Help
Entry
5650              CDS       T01001                                 

Gene name
KLK7, PRSS6, SCCE, hK7
Definition
(RefSeq) kallikrein related peptidase 7 (EC:3.4.21.117)
  KO
K08668  
kallikrein 7 [EC:3.4.21.117]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.117  stratum corneum chymotryptic enzyme
     5650 (KLK7)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   5650 (KLK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.41
AA seq 253 aa AA seqDB search
MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLV
NERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNS
QARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVY
KDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCK
FTKWINDTMKKHR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggcaagatcccttctcctgcccctgcagatcttactgctatccttagccttggaaact
gcaggagaagaagcccagggtgacaagattattgatggcgccccatgtgcaagaggctcc
cacccatggcaggtggccctgctcagtggcaatcagctccactgcggaggcgtcctggtc
aatgagcgctgggtgctcactgccgcccactgcaagatgaatgagtacaccgtgcacctg
ggcagtgatacgctgggcgacaggagagctcagaggatcaaggcctcgaagtcattccgc
caccccggctactccacacagacccatgttaatgacctcatgctcgtgaagctcaatagc
caggccaggctgtcatccatggtgaagaaagtcaggctgccctcccgctgcgaaccccct
ggaaccacctgtactgtctccggctggggcactaccacgagcccagatgtgacctttccc
tctgacctcatgtgcgtggatgtcaagctcatctccccccaggactgcacgaaggtttac
aaggacttactggaaaattccatgctgtgcgctggcatccccgactccaagaaaaacgcc
tgcaatggtgactcagggggaccgttggtgtgcagaggtaccctgcaaggtctggtgtcc
tggggaactttcccttgcggccaacccaatgacccaggagtctacactcaagtgtgcaag
ttcaccaagtggataaatgacaccatgaaaaagcatcgctaa

DBGET integrated database retrieval system