KEGG   Homo sapiens (human): 56521Help
Entry
56521             CDS       T01001                                 

Gene name
DNAJC12, HPANBH4, JDP1
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member C12
  KO
K09532  
DnaJ homolog subfamily C member 12
Organism
hsa  Homo sapiens (human)
Brite
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP40 / DNAJ
   56521 (DNAJC12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9UKB3(Tdark)
UniProt: 
Structure
PDB: 

Jmol
Position
10q21.3
AA seq 198 aa AA seqDB search
MDAILNYRSEDTEDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQ
KAKEILTNEESRARYDHWRRSQMSMPFQQWEALNDSVKTSMHWVVRGKKDLMLEESDKTH
TTKMENEECNEQRERKKEELASTAEKTEQKEPKPLEKSVSPQNSDSSGFADVNGWHLRFR
WSKDAPSELLRKFRNYEI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaatactgaattacaggtcagaagatactgaagattactacacattactggga
tgtgatgaactatcttcggttgaacaaatcctggcagaatttaaagtcagagctctggaa
tgtcacccagacaagcatcctgaaaaccccaaagctgtggagacttttcagaaactgcag
aaggcaaaggagattctgaccaatgaagagagtcgagcccgctatgaccactggcgaagg
agccagatgtcgatgccattccagcagtgggaagctttgaatgactcagtgaagacgtca
atgcactgggttgtcagaggtaaaaaagacctgatgctggaagaatctgacaagactcat
accaccaagatggaaaatgaggaatgtaatgagcaaagagaaagaaagaaagaggagctg
gcttcaaccgcagagaaaacggagcagaaagaacccaagcccctagagaagtcagtctcc
ccgcaaaattcagattcttcaggttttgcagatgtgaatggttggcaccttcgtttccgc
tggtccaaggatgctccctcagaactcctgaggaagttcagaaactatgaaatatga

DBGET integrated database retrieval system