KEGG   Homo sapiens (human): 5655Help
Entry
5655              CDS       T01001                                 

Gene name
KLK10, NES1, PRSSL1
Definition
(RefSeq) kallikrein related peptidase 10 (EC:3.4.21.35)
  KO
K09619  
kallikrein 10 [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     5655 (KLK10)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   5655 (KLK10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13
AA seq 276 aa AA seqDB search
MRAPHLHLSAASGARALAKLLPLLMAQLWAAEAALLPQNDTRLDPEAYGSPCARGSQPWQ
VSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPK
YHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAAR
RVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQ
GILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgagagctccgcacctccacctctccgccgcctctggcgcccgggctctggcgaagctg
ctgccgctgctgatggcgcaactctgggccgcagaggcggcgctgctcccccaaaacgac
acgcgcttggaccccgaagcctatggctccccgtgcgcgcgcggctcgcagccctggcag
gtctcgctcttcaacggcctctcgttccactgcgcgggtgtcctggtggaccagagttgg
gtgctgacggccgcgcactgcggaaacaagccactgtgggctcgagtaggggatgaccac
ctgctgcttcttcagggagagcagctccgccggaccactcgctctgttgtccatcccaag
taccaccagggctcaggccccatcctgccaaggcgaacggatgagcacgatctcatgttg
ctgaagctggccaggcccgtagtgctggggccccgcgtccgggccctgcagcttccctac
cgctgtgctcagcccggagaccagtgccaggttgctggctggggcaccacggccgcccgg
agagtgaagtacaacaagggcctgacctgctccagcatcactatcctgagccctaaagag
tgtgaggtcttctaccctggcgtggtcaccaacaacatgatatgtgctggactggaccgg
ggccaggacccttgccagagtgactctggaggccccctggtctgtgacgagaccctccaa
ggcatcctctcgtggggtgtttacccctgtggctctgcccagcatccagctgtctacacc
cagatctgcaaatacatgtcctggatcaataaagtcatacgctccaactga

DBGET integrated database retrieval system