KEGG   Homo sapiens (human): 56616Help
Entry
56616             CDS       T01001                                 

Gene name
DIABLO, DFNA64, SMAC
Definition
(RefSeq) diablo IAP-binding mitochondrial protein
  KO
K10522  
diablo
Organism
hsa  Homo sapiens (human)
Pathway
Apoptosis
Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    56616 (DIABLO)
   04215 Apoptosis - multiple species
    56616 (DIABLO)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Target recognizing subunit (BTB)
     56616 (DIABLO)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    56616 (DIABLO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q24.31
AA seq 239 aa AA seqDB search
MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIA
QKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSL
LGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQAS
ITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggcggctctgaagagttggctgtcgcgcagcgtaacttcattcttcaggtacagacag
tgtttgtgtgttcctgttgtggctaactttaagaagcggtgtttctcagaattgataaga
ccatggcacaaaactgtgacgattggctttggagtaaccctgtgtgcggttcctattgca
cagaaatcagagcctcattcccttagtagtgaagcattgatgaggagagcagtgtctttg
gtaacagatagcacctctacctttctctctcagaccacatatgcgttgattgaagctatt
actgaatatactaaggctgtttataccttaacttctctttaccgacaatatacaagttta
cttgggaaaatgaattcagaggaggaagatgaagtgtggcaggtgatcataggagccaga
gctgagatgacttcaaaacaccaagagtacttgaagctggaaaccacttggatgactgca
gttggtctttcagagatggcagcagaagctgcatatcaaactggcgcagatcaggcctct
ataaccgccaggaatcacattcagctggtgaaactgcaggtggaagaggtgcaccagctc
tcccggaaagcagaaaccaagctggcagaagcacagatagaagagctccgtcagaaaaca
caggaggaaggggaggagcgggctgagtcggagcaggaggcctacctgcgtgaggattga

DBGET integrated database retrieval system