KEGG   Homo sapiens (human): 56648Help
Entry
56648             CDS       T01001                                 

Gene name
EIF5A2, EIF-5A2, eIF5AII
Definition
(RefSeq) eukaryotic translation initiation factor 5A2
  KO
K03263  translation initiation factor 5A
Organism
hsa  Homo sapiens (human)
Brite
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Initiation factors
   eIF-5
    56648 (EIF5A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-5a EFP_N
Motif
Other DBs
NCBI-GeneID: 56648
NCBI-ProteinID: NP_065123
OMIM: 605782
HGNC: 3301
Ensembl: ENSG00000163577
Vega: OTTHUMG00000158958
Pharos: Q9GZV4(Tbio)
UniProt: Q9GZV4
Position
3q26.2
AA seq 153 aa AA seqDB search
MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVG
IDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELG
KEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgaaattgatttcactactggagatgccggggcttccagcacttaccctatg
cagtgctcggccttgcgcaaaaacggcttcgtggtgctcaaaggacgaccatgcaaaata
gtggagatgtcaacttccaaaactggaaagcatggtcatgccaaggttcaccttgttgga
attgatattttcacgggcaaaaaatatgaagatatttgtccttctactcacaacatggat
gttccaaatattaagagaaatgattatcaactgatatgcattcaagatggttacctttcc
ctgctgacagaaactggtgaagttcgtgaggatcttaaactgccagaaggtgaactaggc
aaagaaatagagggaaaatacaatgcaggtgaagatgtacaggtgtctgtcatgtgtgca
atgagtgaagaatatgctgtagccataaaaccctgcaaataa

DBGET integrated database retrieval system