KEGG   Homo sapiens (human): 56648Help
Entry
56648             CDS       T01001                                 

Gene name
EIF5A2, EIF-5A2, eIF5AII
Definition
(RefSeq) eukaryotic translation initiation factor 5A2
  KO
K03263  
translation initiation factor 5A
Organism
hsa  Homo sapiens (human)
Brite
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Initiation factors
   eIF-5
    56648 (EIF5A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q26.2
AA seq 153 aa AA seqDB search
MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVG
IDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELG
KEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgaaattgatttcactactggagatgccggggcttccagcacttaccctatg
cagtgctcggccttgcgcaaaaacggcttcgtggtgctcaaaggacgaccatgcaaaata
gtggagatgtcaacttccaaaactggaaagcatggtcatgccaaggttcaccttgttgga
attgatattttcacgggcaaaaaatatgaagatatttgtccttctactcacaacatggat
gttccaaatattaagagaaatgattatcaactgatatgcattcaagatggttacctttcc
ctgctgacagaaactggtgaagttcgtgaggatcttaaactgccagaaggtgaactaggc
aaagaaatagagggaaaatacaatgcaggtgaagatgtacaggtgtctgtcatgtgtgca
atgagtgaagaatatgctgtagccataaaaccctgcaaataa

DBGET integrated database retrieval system