KEGG   Homo sapiens (human): 56659Help
Entry
56659             CDS       T01001                                 

Gene name
KCNK13, K2p13.1, THIK-1, THIK1
Definition
(RefSeq) potassium two pore domain channel subfamily K member 13
  KO
K04922  
potassium channel subfamily K member 13
Organism
hsa  Homo sapiens (human)
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNK, K2px.x
   56659 (KCNK13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q32.11
AA seq 408 aa AA seqDB search
MAGRGFSWGPGHLNEDNARFLLLAALIVLYLLGGAAVFSALELAHERQAKQRWEERLANF
SRGHNLSRDELRGFLRHYEEATRAGIRVDNVRPRWDFTGAFYFVGTVVSTIGFGMTTPAT
VGGKIFLIFYGLVGCSSTILFFNLFLERLITIIAYIMKSCHQRQLRRRGALPQESLKDAG
QCEVDSLAGWKPSVYYVMLILCTASILISCCASAMYTPIEGWSYFDSLYFCFVAFSTIGF
GDLVSSQNAHYESQGLYRFANFVFILMGVCCIYSLFNVISILIKQSLNWILRKMDSGCCP
QCQRGLLRSRRNVVMPGSVRNRCNISIETDGVAESDTDGRRLSGEMISMKDLLAANKASL
AILQKQLSEMANGCPHQTSTLARDNEFSGGVGAFAIMNNRLAETSGDR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggctggccggggtttcagctggggcccgggccacctgaacgaggacaacgcgcgcttt
ctgctgctggccgcgctcatcgtgctctacctgctgggcggcgccgccgtcttctccgcg
ctggagctggcgcacgagcgccaggccaagcagcgctgggaggagcgcctggccaacttc
agccgcggccacaacctgagccgcgacgagctgcgcggcttcctccgccactacgaggag
gccactcgggccggcatccgcgtggacaacgtccgcccgcgctgggacttcaccggcgcc
ttctacttcgtgggcaccgtcgtttccaccatagggtttgggatgacaactccggcgaca
gtaggaggaaaaatctttctgatcttttacggccttgttgggtgttccagcaccatcttg
ttcttcaacctcttcctggagcgcctgatcaccatcatcgcctacatcatgaagtcgtgc
caccagcggcagctccggagacgaggggccctgccccaggagagcctgaaggatgcgggg
cagtgtgaggtggacagcctggccggctggaagccctccgtgtactacgtcatgctgatc
ctatgcacagcctccatcctcatctcttgctgcgcctcagccatgtacacccccattgaa
ggctggagctactttgactcactctacttctgttttgtggctttcagcaccattggcttt
ggggacctggtcagcagccagaacgcccactatgagagccaaggcctctatcgctttgcc
aacttcgtcttcatcctcatgggtgtctgctgcatctactccttgttcaatgtcatctct
atcctcatcaaacagtccttgaactggatcctgaggaaaatggacagcgggtgctgcccg
caatgccagagaggactcttgcgatcacgcaggaacgtggtgatgccaggcagcgtccgg
aaccgctgcaacatctccatagagacagacggggtggcagagagtgacacggacgggcgc
cggctctcaggggagatgatctccatgaaggacttgctggcagccaacaaggcctcgttg
gccatcctgcagaagcaactgtctgagatggccaacggctgcccccaccagaccagcaca
ctggcccgggacaatgaattctcagggggggtgggagcctttgcaatcatgaacaacagg
ttggcagagaccagtggggacaggtag

DBGET integrated database retrieval system