KEGG   Homo sapiens (human): 56681Help
Entry
56681             CDS       T01001                                 

Gene name
SAR1A, SAR1, SARA1, Sara, masra2
Definition
secretion associated, Ras related GTPase 1A
Orthology
K07953  
GTP-binding protein SAR1 [EC:3.6.5.-]
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Legionellosis
Module
COPII complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    56681 (SAR1A)
 Human Diseases
  Infectious diseases
   05134 Legionellosis
    56681 (SAR1A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     56681 (SAR1A)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Arf/Sar Family
   Sar
    56681 (SAR1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q22.1
AA seq 198 aa AA seqDB search
MSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPT
SEELTIAGMTFTTFDLGGHEQARRVWKNYLPAINGIVFLVDCADHSRLVESKVELNALMT
DETISNVPILILGNKIDRTDAISEEKLREIFGLYGQTTGKGNVTLKELNARPMEVFMCSV
LKRQGYGEGFRWLSQYID
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcatctttgagtggatctacaatggcttcagcagtgtgctccagttcctagga
ctgtacaagaaatctggaaaacttgtattcttaggtttggataatgcaggcaaaaccact
cttcttcacatgctcaaagatgacagattgggccaacatgttccaacactacatccgaca
tcagaagagctaacaattgctggaatgacctttacaacttttgatcttggtgggcacgag
caagcacgtcgcgtttggaaaaattatctcccagcaattaatgggattgtctttctggtg
gactgtgcagatcattctcgcctcgtggaatccaaagttgagcttaatgctttaatgact
gatgaaacaatatccaatgtgccaatccttatcttgggtaacaaaattgacagaacagat
gcaatcagtgaagaaaaactccgtgagatatttgggctttatggacagaccacaggaaag
gggaatgtgaccctgaaggagctgaatgctcgccccatggaagtgttcatgtgcagtgtg
ctcaagaggcaaggttacggcgagggtttccgctggctctcccagtatattgactga

DBGET integrated database retrieval system