KEGG   Homo sapiens (human): 56729Help
Entry
56729             CDS       T01001                                 

Gene name
RETN, ADSF, FIZZ3, RETN1, RSTN, XCP1
Definition
(RefSeq) resistin
  KO
K13438  
resistin
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.2
AA seq 108 aa AA seqDB search
MKALCLLLLPVLGLLVSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDL
ATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctctctgtctcctcctcctccctgtcctggggctgttggtgtctagcaagacc
ctgtgctccatggaagaagccatcaatgagaggatccaggaggtcgccggctccctaata
tttagggcaataagcagcattggcctggagtgccagagcgtcacctccaggggggacctg
gctacttgcccccgaggcttcgccgtcaccggctgcacttgtggctccgcctgtggctcg
tgggatgtgcgcgccgagaccacatgtcactgccagtgcgcgggcatggactggaccgga
gcgcgctgctgtcgtgtgcagccctga

DBGET integrated database retrieval system