KEGG   Homo sapiens (human): 56729Help
Entry
56729             CDS       T01001                                 

Gene name
RETN, ADSF, FIZZ3, RETN1, RSTN, XCP1
Definition
(RefSeq) resistin
  KO
K13438  resistin
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Resistin CBM_1
Motif
Other DBs
NCBI-GeneID: 56729
NCBI-ProteinID: NP_001180303
OMIM: 605565
HGNC: 20389
Ensembl: ENSG00000104918
Vega: OTTHUMG00000182503
Pharos: Q9HD89(Tbio)
UniProt: Q9HD89
Position
19p13.2
AA seq 108 aa AA seqDB search
MKALCLLLLPVLGLLVSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDL
ATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctctctgtctcctcctcctccctgtcctggggctgttggtgtctagcaagacc
ctgtgctccatggaagaagccatcaatgagaggatccaggaggtcgccggctccctaata
tttagggcaataagcagcattggcctggagtgccagagcgtcacctccaggggggacctg
gctacttgcccccgaggcttcgccgtcaccggctgcacttgtggctccgcctgtggctcg
tgggatgtgcgcgccgagaccacatgtcactgccagtgcgcgggcatggactggaccgga
gcgcgctgctgtcgtgtgcagccctga

DBGET integrated database retrieval system