KEGG   Homo sapiens (human): 56751Help
Entry
56751             CDS       T01001                                 

Gene name
BARHL1
Definition
(RefSeq) BarH like homeobox 1
  KO
K09360  
BarH-like
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, not assigned
    56751 (BARHL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9BZE3(Tbio)
UniProt: 
Position
9q34.13
AA seq 327 aa AA seqDB search
MEGSNGFGIDSILSHRAGSPALPKGDPLLGDCRSPLELSPRSESSSDCSSPASPGRDCLE
TGTPRPGGASGPGLDSHLQPGQLSAPAQSRTVTSSFLIRDILADCKPLAACAPYSSSGQP
AAPEPGGRLAAKAAEDFRDKLDKSGSNASSDSEYKVKEEGDREISSSRDSPPVRLKKPRK
ARTAFTDHQLAQLERSFERQKYLSVQDRMELAASLNLTDTQVKTWYQNRRTKWKRQTAVG
LELLAEAGNYSALQRMFPSPYFYPQSLVSNLDPGAALYLYRGPSAPPPALQRPLVPRILI
HGLQGASEPPPPLPPLAGVLPRAAQPR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggaaggctccaatggctttgggatcgactccattctctcccaccgcgcgggcagcccc
gcccttcccaagggggaccccttgctcggggactgccgttcgcccctggagctgagtcca
cgctcagagagcagcagcgactgctcttcgccagcctctccaggaagggactgtttggag
acggggaccccacggcctggcggggcatccggcccaggtttggactcccacctgcagccc
gggcagctctcagccccggcccagtcgcgcaccgtcacctcctcctttctgatcagggac
atccttgccgactgcaaaccactcgcggcctgtgcaccctactctagcagcgggcagccg
gcagcccctgagcctgggggccgccttgcggccaaggccgcggaggactttagagacaag
ctggacaaaagtggcagcaacgcctcatcggactctgagtataaagtgaaggaggagggc
gaccgcgagatctccagctccagggacagtcccccggtgcgcctgaaaaagccacgcaag
gcgcgcacggccttcaccgaccatcagctggcgcagctggagcgcagcttcgagcggcag
aagtacctgagcgtgcaggaccgcatggagctcgccgcctcgctcaacctcaccgacacg
caggtcaagacctggtaccagaaccgcaggactaaatggaagcgacagacggccgtcggg
ttggagctgctggcggaggcaggcaattactcagcgctccagcggatgttcccgtcgcct
tatttctacccgcagagtctggtttccaacctggaccccggcgcggcgctctacctgtac
cgcggccccagcgcgccgccgcctgctctccagagacctctggtgccccgcatcctcatc
cacggactccagggcgccagcgagccgcccccgccgctgccccccctggccggcgtcctc
ccacgcgccgcgcagcctcggtga

DBGET integrated database retrieval system