KEGG   Homo sapiens (human): 56776Help
Entry
56776             CDS       T01001                                 

Gene name
FMN2
Definition
(RefSeq) formin 2
  KO
K02184  
formin 2
Organism
hsa  Homo sapiens (human)
Disease
H00768  
Nonsyndromic autosomal recessive mental retardation (NS-ARMR)
Brite
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Formins
     56776 (FMN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9NZ56(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
1q43
AA seq 1722 aa AA seqDB search
MGNQDGKLKRSAGDALHEGGGGAEDALGPRDVEATKKGSGGKKALGKHGKGGGGGGGGGE
SGKKKSKSDSRASVFSNLRIRKNLSKGKGAGGSREDVLDSQALQTGELDSAHSLLTKTPD
LSLSADEAGLSDTECADPFEVTGPGGPGPAEARVGGRPIAEDVETAAGAQDGQRTSSGSD
TDIYSFHSATEQEDLLSDIQQAIRLQQQQQQQLQLQLQQQQQQQQLQGAEEPAAPPTAVS
PQPGAFLGLDRFLLGPSGGAGEAPGSPDTEQALSALSDLPESLAAEPREPQQPPSPGGLP
VSEAPSLPAAQPAAKDSPSSTAFPFPEAGPGEEAAGAPVRGAGDTDEEGEEDAFEDAPRG
SPGEEWAPEVGEDAPQRLGEEPEEEAQGPDAPAAASLPGSPAPSQRCFKPYPLITPCYIK
TTTRQLSSPNHSPSQSPNQSPRIKRRPEPSLSRGSRTALASVAAPAKKHRADGGLAAGLS
RSADWTEELGARTPRVGGSAHLLERGVASDSGGGVSPALAAKASGAPAAADGFQNVFTGR
TLLEKLFSQQENGPPEEAEKFCSRIIAMGLLLPFSDCFREPCNQNAQTNAASFDQDQLYT
WAAVSQPTHSLDYSEGQFPRRVPSMGPPSKPPDEEHRLEDAETESQSAVSETPQKRSDAV
QKEVVDMKSEGQATVIQQLEQTIEDLRTKIAELERQYPALDTEVASGHQGLENGVTASGD
VCLEALRLEEKEVRHHRILEAKSIQTSPTEEGGVLTLPPVDGLPGRPPCPPGAESGPQTK
FCSEISLIVSPRRISVQLDSHQPTQSISQPPPPPSLLWSAGQGQPGSQPPHSISTEFQTS
HEHSVSSAFKNSCNIPSPPPLPCTESSSSMPGLGMVPPPPPPLPGMTVPTLPSTAIPQPP
PLQGTEMLPPPPPPLPGAGIPPPPPLPGAGILPLPPLPGAGIPPPPPLPGAAIPPPPPLP
GAGIPLPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP
PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPL
PGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGI
PPPPPLPRVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGVGIPPPPP
LPGAGIPPPPPLPGMGIPPAPAPPLPPPGTGIPPPPLLPVSGPPLLPQVGSSTLPTPQVC
GFLPPPLPSGLFGLGMNQDKGSRKQPIEPCRPMKPLYWTRIQLHSKRDSSTSLIWEKIEE
PSIDCHEFEELFSKTAVKERKKPISDTISKTKAKQVVKLLSNKRSQAVGILMSSLHLDMK
DIQHAVVNLDNSVVDLETLQALYENRAQSDELEKIEKHGRSSKDKENAKSLDKPEQFLYE
LSLIPNFSERVFCILFQSTFSESICSIRRKLELLQKLCETLKNGPGVMQVLGLVLAFGNY
MNGGNKTRGQADGFGLDILPKLKDVKSSDNSRSLLSYIVSYYLRNFDEDAGKEQCLFPLP
EPQDLFQASQMKFEDFQKDLRKLKKDLKACEVEAGKVYQVSSKEHMQPFKENMEQFIIQA
KIDQEAEENSLTETHKCFLETTAYFFMKPKLGEKEVSPNAFFSIWHEFSSDFKDFWKKEN
KLLLQERVKEAEEVCRQKKGKSLYKIKPRHDSGIKAKISMKT
NT seq 5169 nt NT seq  +upstreamnt  +downstreamnt
atggggaaccaggatgggaagctgaagaggagcgcaggtgatgctttgcacgaaggcggc
ggtggcgccgaggatgcgctggggcccagggatgtggaagccacaaagaaggggagcggg
ggcaagaaggcgctaggcaagcacggcaaggggggagggggcggcggcggcggcggggag
tcgggcaagaagaagagcaagtccgactccagagcctcggtgttttccaacctgcggatc
aggaagaatctgtccaaggggaaaggcgccggcggctcccgcgaagatgtactggattcc
caggccctgcagaccggggagctggacagcgctcactccctgctcaccaagactccagac
ctcagcctctcggcggacgaggccggcctgtcggataccgagtgtgcggacccttttgag
gtgaccggtccagggggtcctgggcctgccgaggctagggtcgggggccggccgatcgcc
gaggatgtggaaactgcagcaggggcgcaggatggacaaaggaccagctcgggctcggac
acggacatctatagcttccattcggctacggagcaagaggatttgctttcagacatccag
caggcgatccgcctgcagcagcagcagcagcagcagctccagctccagctccagcaacag
cagcagcagcagcagctccagggcgccgaggagcctgcagcgccccccactgccgtctcc
cctcagcccggggccttcctgggcctggaccggttcctgctggggccgagcggcggggct
ggggaggccccgggcagtccggacaccgagcaggcgctgtccgcgctctccgacctgccc
gagagcctggccgccgagccccgggagccccagcaaccgccgtcccccggcggcctcccg
gtctccgaggcgcccagtctcccggcagcgcaacccgcggccaaagactcgccctcctcc
acggctttcccatttcccgaggccgggccgggggaggaagcggccggagcccccgtgcga
ggggctggggacacggatgaggagggtgaggaggatgcttttgaggatgcgccccggggc
tctccgggggaggagtgggccccggaggtgggagaggacgccccgcagaggctgggggaa
gagccggaggaggaggcgcaaggacctgacgcccccgcggccgcttccctgcccggcagc
cccgcgcctagccagcgctgtttcaagccctacccgctcatcaccccctgctacatcaag
accaccacccggcagctcagctcgcccaatcactccccgtctcagtcccctaatcagagc
cccaggatcaagaggcggccggaaccctccctgagccgagggtccagaactgccctggcc
tccgtagccgccccggccaagaagcaccgggccgacggcggccttgcggccggcctgagc
cgctcggctgactggacggaggagctaggcgcccgcacgccccgggtgggaggctccgcg
cacctgctggagcgcggggtggcgagtgacagcggcggtggggtgtccccagcactggcc
gccaaggcgtctggggcccccgcggctgcggatggcttccagaacgtgttcacagggcga
acgctgttggagaagctgttcagccagcaggagaacgggcctccagaagaagcagagaag
ttttgctcccggatcattgccatgggtcttctccttccttttagtgattgcttcagggaa
ccgtgtaatcagaatgcccagacgaatgcagcttcgtttgatcaagatcaactttatacc
tgggctgcagttagtcaacccacacactcattggactattcagaagggcagtttcctagg
cgagttccatccatggggccaccatccaaacctcccgatgaggaacacaggctcgaggat
gctgaaacagaatctcaatctgctgtttcagaaactccccaaaaacgctcagatgctgtc
cagaaggaagttgttgacatgaagtctgagggacaggccactgtaattcagcagctggaa
cagactattgaggatctgagaaccaaaatagctgaactagagaggcagtatcctgccctg
gacacagaggtggccagtggtcatcaagggcttgagaatggagtgacagcctcaggcgat
gtctgtctcgaagctctcaggttagaagaaaaggaagtacggcatcataggattttagag
gcgaaatcgatacagacttcccccacggaagagggcggggtgctgacactgcctcctgtg
gatgggctgccagggcgtcctccatgcccccctggggctgaaagtggacctcagacaaag
ttctgttcagagatttctttgattgtgtctccaaggcgaatatcagtccagctcgacagc
catcagcccacacagagcatctcacagcctccaccacctccatcccttctgtggtctgct
gggcaaggacagcctgggtcacagccgccccattctatttctaccgagtttcaaaccagc
cacgaacactctgtttcctctgcctttaaaaacagctgtaacatcccatctccaccacct
ctgccttgcacagagtcctccagctccatgcctggcctgggcatggtgcctcccccacct
ccccctctccctggcatgacagtgcctactctgcccagtacagccattccccaacctcct
cctctgcagggtacagaaatgctgccaccccctccccctcctcttcccggagcgggcata
cctcctccgccgcctctacccggagcaggcatactccctctgccccctctacccggagcg
ggaatacctcctccgccccctctacccggagcggcaataccccctccgccccctcttccc
ggggcaggcataccccttcctccccctcttcccggagcaggaatacctcctccaccccct
ctacccggagcgggcataccccctcctcccccacttcccggagcgggcataccccctccg
cccccacttcccggagcgggcataccccctcctccccctcttcccggagcgggcatacct
cctccaccccctctacccggagcgggcataccccctccgcccccacttcccggagcgggc
ataccccctccgcccccacttcccggagcgggcataccccctcctccccctcttcccgga
gcgggcatacctcctccaccccctctacccggagcgggcataccccctccgcccccactt
cccggagcgggcatacccccacctccccctctacccggagcgggcataccccctccgccc
cctctacccggagtgggcatacctcctccgccccctctacccggagcgggcataccccct
cctccccctctacccggagcgggcataccccctcctccccctcttcccggagcgggcata
cctcctccaccccctctacccagagtgggcataccccctccgcccccacttcccggagcg
ggcatacccccacctccccctctacccggagcgggcataccccctccgccccctctacct
ggagtgggaatacctcctccgccccctctacctggagtgggaatacctcctccgccccct
ctacctggtgctgggattcccccacctcctcccttgccaggtatggggattccacctgct
ccagctcccccactccctccacctgggacaggaatcccaccgccccctctgcttcctgta
tcaggccctccactcctcccacaagttgggagtagcactttaccaaccccacaggtgtgt
ggatttcttcctcctccattgccaagtggcttgtttggattagggatgaatcaggacaaa
gggagtaggaagcagcccatagagccttgtcgaccaatgaagcctctttactggaccagg
attcaactacatagtaaaagagactccagtacttcacttatttgggaaaaaattgaagag
ccatccatagattgtcatgaatttgaggaattattttctaaaactgctgtaaaggagaga
aagaaacctatctctgatactatctcaaagacgaaggctaaacaagttgtcaagttatta
agcaacaaaagatcacaagcagttggaatactaatgtctagccttcatttagatatgaaa
gacatacaacatgctgttgtgaacttggataattctgtggttgacctggagacccttcaa
gctctctatgagaatagagcacagtcagacgaactcgaaaaaatagaaaagcatggccga
tcttccaaagacaaggaaaatgccaagtctctggacaaacctgaacagttcctttatgaa
ctgtcactaatccccaacttttcagagcgagtcttttgcatcctgttccagtccacattt
tcagaaagcatttgctcaattcgtcgcaaactggaattactacagaaattgtgtgagaca
ttaaaaaatggcccaggggttatgcaggttctaggtttggttcttgcctttggcaactac
atgaatggaggaaataagactcgaggacaggcagatggctttggattagacattcttcca
aaactgaaagatgtcaagagcagtgacaatagcagaagccttttgtcatatattgtttcg
tattatctccgaaattttgatgaggatgctggaaaagaacagtgcctctttccactgcca
gaaccccaggacctttttcaggcctcacagatgaagtttgaagattttcaaaaagatctc
agaaaactgaagaaagacttgaaagcctgtgaagttgaagcagggaaagtataccaggtc
tcctcaaaagagcatatgcagcctttcaaggaaaacatggaacaatttattattcaagcc
aaaattgaccaagaggcagaggaaaattcactgacagagactcataaatgctttttggag
accacggcatatttcttcatgaaaccaaaacttggagagaaggaggtgtccccaaatgct
ttcttcagtatctggcatgaattcagctctgactttaaagacttctggaagaaagagaac
aaacttcttctacaagagagagtaaaagaagccgaagaggtgtgtagacagaagaaagga
aaatcactttataaaataaaaccaagacatgactctggaattaaagcaaagataagcatg
aaaacttga

DBGET integrated database retrieval system