KEGG   Homo sapiens (human): 56832Help
Entry
56832             CDS       T01001                                 

Gene name
IFNK, IFNT1, INFE1, RP11-27J8.1
Definition
interferon, kappa
Orthology
K05441  
interferon, kappa
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
RIG-I-like receptor signaling pathway
Jak-STAT signaling pathway
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:hsa04622]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9
AA seq 207 aa AA seqDB search
MSTKPDMIQKCLWLEILMGIFIAGTLSLDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECL
RENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQ
QAEYLNQCLEEDKNENEDMKEMKENEMKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSD
CAWEIVRVEIRRCLYYFYKFTALFRRK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccaaacctgatatgattcaaaagtgtttgtggcttgagatccttatgggtata
ttcattgctggcaccctatccctggactgtaacttactgaacgttcacctgagaagagtc
acctggcaaaatctgagacatctgagtagtatgagcaattcatttcctgtagaatgtcta
cgagaaaacatagcttttgagttgccccaagagtttctgcaatacacccaacctatgaag
agggacatcaagaaggccttctatgaaatgtccctacaggccttcaacatcttcagccaa
cacaccttcaaatattggaaagagagacacctcaaacaaatccaaataggacttgatcag
caagcagagtacctgaaccaatgcttggaggaagacaagaatgaaaatgaagacatgaaa
gaaatgaaagagaatgagatgaaaccctcagaagccagggtcccccagctgagcagcctg
gaactgaggagatatttccacaggatagacaatttcctgaaagaaaagaaatacagtgac
tgtgcctgggagattgtccgagtggaaatcagaagatgtttgtattacttttacaaattt
acagctctattcaggaggaaataa

DBGET integrated database retrieval system