KEGG   Homo sapiens (human): 56832Help
Entry
56832             CDS       T01001                                 

Gene name
IFNK, IFNT1, INFE1
Definition
(RefSeq) interferon kappa
  KO
K05441  interferon kappa
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04622  RIG-I-like receptor signaling pathway
hsa04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    56832 (IFNK)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    56832 (IFNK)
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    56832 (IFNK)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   56832 (IFNK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interferon
Motif
Other DBs
NCBI-GeneID: 56832
NCBI-ProteinID: NP_064509
OMIM: 615326
HGNC: 21714
Ensembl: ENSG00000147896
Vega: OTTHUMG00000019715
Pharos: Q9P0W0(Tbio)
UniProt: Q9P0W0
Position
9p21.2
AA seq 207 aa AA seqDB search
MSTKPDMIQKCLWLEILMGIFIAGTLSLDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECL
RENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQ
QAEYLNQCLEEDKNENEDMKEMKENEMKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSD
CAWEIVRVEIRRCLYYFYKFTALFRRK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccaaacctgatatgattcaaaagtgtttgtggcttgagatccttatgggtata
ttcattgctggcaccctatccctggactgtaacttactgaacgttcacctgagaagagtc
acctggcaaaatctgagacatctgagtagtatgagcaattcatttcctgtagaatgtcta
cgagaaaacatagcttttgagttgccccaagagtttctgcaatacacccaacctatgaag
agggacatcaagaaggccttctatgaaatgtccctacaggccttcaacatcttcagccaa
cacaccttcaaatattggaaagagagacacctcaaacaaatccaaataggacttgatcag
caagcagagtacctgaaccaatgcttggaggaagacaagaatgaaaatgaagacatgaaa
gaaatgaaagagaatgagatgaaaccctcagaagccagggtcccccagctgagcagcctg
gaactgaggagatatttccacaggatagacaatttcctgaaagaaaagaaatacagtgac
tgtgcctgggagattgtccgagtggaaatcagaagatgtttgtattacttttacaaattt
acagctctattcaggaggaaataa

DBGET integrated database retrieval system